dTDP-4-dehydrorhamnose 3,5-epimerase
Details
- Name
- dTDP-4-dehydrorhamnose 3,5-epimerase
- Synonyms
- 5.1.3.13
- dTDP-4-keto-6-deoxyglucose 3,5-epimerase
- dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase
- dTDP-L-rhamnose synthase
- strM
- Thymidine diphospho-4-keto-rhamnose 3,5-epimerase
- Gene Name
- rmlC
- Organism
- Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
- Amino acid sequence
>lcl|BSEQ0051215|dTDP-4-dehydrorhamnose 3,5-epimerase MKARELDVPGAWEITPTIHVDSRGLFFEWLTDHGFRAFAGHSLDVRQVNCSVSSAGVLRG LHFAQLPPSQAKYVTCVSGSVFDVVVDIREGSPTFGRWDSVLLDDQDRRTIYVSEGLAHG FLALQDNSTVMYLCSAEYNPQREHTICATDPTLAVDWPLVDGAAPSLSDRDAAAPSFEDV RASGLLPRWEQTQRFIGEMRGT
- Number of residues
- 202
- Molecular Weight
- 22313.775
- Theoretical pI
- Not Available
- GO Classification
- FunctionsdTDP-4-dehydrorhamnose 3,5-epimerase activityProcessesdTDP-rhamnose biosynthetic process / extracellular polysaccharide biosynthetic process / growth
- General Function
- Catalyzes the epimerization of the C3' and C5'positions of dTDP-6-deoxy-D-xylo-4-hexulose, forming dTDP-6-deoxy-L-lyxo-4-hexulose. Involved in the biosynthesis of the dTDP-L-rhamnose which is a component of the critical linker, D-N-acetylglucosamine-L-rhamnose disaccharide, which connects the galactan region of arabinogalactan to peptidoglycan via a phosphodiester linkage.
- Specific Function
- Dtdp-4-dehydrorhamnose 3,5-epimerase activity
- Pfam Domain Function
- dTDP_sugar_isom (PF00908)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0051216|dTDP-4-dehydrorhamnose 3,5-epimerase (rmlC) ATGAAAGCACGCGAACTCGACGTCCCCGGCGCCTGGGAGATTACCCCGACCATCCATGTC GATTCCCGCGGACTGTTCTTCGAATGGCTTACCGATCATGGGTTCCGCGCATTCGCAGGT CACAGTTTGGACGTCCGGCAAGTGAACTGCTCGGTGTCATCGGCCGGTGTGCTGCGCGGC CTGCACTTTGCCCAGTTGCCGCCGAGCCAGGCCAAGTATGTGACCTGCGTTTCCGGCTCG GTGTTCGATGTCGTCGTCGACATCCGAGAGGGCTCACCGACATTCGGCCGATGGGACTCG GTGCTGCTCGACGACCAAGACCGTAGGACGATCTACGTCTCCGAAGGCCTAGCGCACGGC TTCCTTGCACTGCAAGACAATTCGACGGTGATGTACTTGTGCTCGGCGGAATACAATCCG CAGCGCGAGCACACCATCTGCGCCACAGATCCGACGTTGGCGGTCGATTGGCCGCTGGTC GATGGCGCTGCCCCCAGCCTGTCCGACCGTGATGCCGCTGCGCCCAGCTTCGAGGATGTG CGCGCGTCTGGCCTGCTGCCCAGGTGGGAACAGACGCAGCGGTTCATTGGGGAGATGCGC GGCACCTAG
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P9WH11 UniProtKB Entry Name RMLC_MYCTU - General References
- Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S, Barry CE 3rd, Tekaia F, Badcock K, Basham D, Brown D, Chillingworth T, Connor R, Davies R, Devlin K, Feltwell T, Gentles S, Hamlin N, Holroyd S, Hornsby T, Jagels K, Krogh A, McLean J, Moule S, Murphy L, Oliver K, Osborne J, Quail MA, Rajandream MA, Rogers J, Rutter S, Seeger K, Skelton J, Squares R, Squares S, Sulston JE, Taylor K, Whitehead S, Barrell BG: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Nature. 1998 Jun 11;393(6685):537-44. [Article]
- Li W, Xin Y, McNeil MR, Ma Y: rmlB and rmlC genes are essential for growth of mycobacteria. Biochem Biophys Res Commun. 2006 Mar 31;342(1):170-8. Epub 2006 Feb 3. [Article]
- Raman K, Yeturu K, Chandra N: targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis. BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109. [Article]
- Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A: Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3. [Article]
- Babaoglu K, Page MA, Jones VC, McNeil MR, Dong C, Naismith JH, Lee RE: Novel inhibitors of an emerging target in Mycobacterium tuberculosis; substituted thiazolidinones as inhibitors of dTDP-rhamnose synthesis. Bioorg Med Chem Lett. 2003 Oct 6;13(19):3227-30. [Article]
- Kantardjieff KA, Kim CY, Naranjo C, Waldo GS, Lekin T, Segelke BW, Zemla A, Park MS, Terwilliger TC, Rupp B: Mycobacterium tuberculosis RmlC epimerase (Rv3465): a promising drug-target structure in the rhamnose pathway. Acta Crystallogr D Biol Crystallogr. 2004 May;60(Pt 5):895-902. Epub 2004 Apr 21. [Article]
- Dong C, Major LL, Srikannathasan V, Errey JC, Giraud MF, Lam JS, Graninger M, Messner P, McNeil MR, Field RA, Whitfield C, Naismith JH: RmlC, a C3' and C5' carbohydrate epimerase, appears to operate via an intermediate with an unusual twist boat conformation. J Mol Biol. 2007 Jan 5;365(1):146-59. Epub 2006 Sep 29. [Article]