Mannitol dehydrogenase

Details

Name
Mannitol dehydrogenase
Synonyms
  • EC 1.1.1.67
Gene Name
mtlD
Organism
Pseudomonas fluorescens
Amino acid sequence
>lcl|BSEQ0022423|Mannitol dehydrogenase
MKLNKQNLTQLAPEVKLPAYTLADTRQGIAHIGVGGFHRAHQAYYTDALMNTGEGLDWSI
CGVGLRSEDRKARDDLAGQDYLFTLYELGDTDDTEVRVIGSISDMLLAEDSAQALIDKLA
SPEIRIVSLTITEGGYCIDDSNGEFMAHLPQIQHDLAHPSSPKTVFGFICAALTQRRAAG
IPAFTVMSCDNLPHNGAVTRKALLAFAALHNAELHDWIKAHVSFPNAMVDRITPMTSTAH
RLQLHDEHGIDDAWPVVCEPFVQWVLEDKFVNGRPAWEKVGVQFTDDVTPYEEMKIGLLN
GSHLALTYLGFLKGYRFVHETMNDPLFVAYMRAYMDLDVTPNLAPVPGIDLTDYKQTLVD
RFSNQAIADQLERVCSDGSSKFPKFTVPTINRLIADGRETERAALVVAAWALYLKGVDEN
GVSYTIPDPRAEFCQGLVSDDALISQRLLAVEEIFGTAIPNSPEFVAAFERCYGSLRDNG
VTTTLKHLLKKPV
Number of residues
493
Molecular Weight
54497.41
Theoretical pI
4.95
GO Classification
Functions
nucleotide binding / coenzyme binding / mannitol 2-dehydrogenase activity
Processes
mannitol metabolic process
General Function
Nucleotide binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0005128|1482 bp
ATGAAACTGAATAAGCAGAACCTCACCCAGCTGGCGCCCGAAGTGAAATTGCCAGCCTAT
ACGCTTGCCGACACACGCCAGGGCATCGCCCATATCGGCGTCGGCGGCTTCCATCGCGCG
CACCAGGCGTATTACACCGATGCGCTGATGAATACCGGCGAGGGCCTGGACTGGAGCATC
TGCGGCGTTGGCCTGCGCAGCGAGGACCGCAAGGCCCGCGATGACCTGGCCGGCCAGGAC
TACCTGTTCACCCTGTACGAACTGGGCGACACCGACGACACCGAAGTGCGCGTGATCGGC
TCGATCAGCGACATGCTGCTGGCCGAAGACAGCGCCCAGGCATTGATCGATAAACTGGCC
AGCCCCGAGATTCGCATCGTCTCGCTGACCATCACCGAAGGCGGCTACTGCATCGACGAC
AGCAACGGCGAATTCATGGCCCACTTGCCGCAGATCCAGCACGACCTGGCTCATCCGTCG
TCGCCAAAAACCGTGTTCGGCTTTATCTGCGCGGCATTGACCCAGCGCCGCGCGGCCGGC
ATCCCGGCGTTTACCGTGATGTCCTGCGATAACCTGCCCCACAATGGCGCTGTCACGCGC
AAGGCACTGCTGGCGTTCGCCGCCCTGCACAACGCCGAGCTGCATGACTGGATCAAGGCC
CATGTGAGCTTCCCGAACGCCATGGTCGACCGCATCACGCCGATGACCAGCACCGCCCAC
CGCCTGCAACTGCACGATGAACACGGCATCGACGATGCCTGGCCAGTTGTTTGCGAACCC
TTTGTGCAGTGGGTACTGGAAGACAAATTCGTCAACGGCCGCCCGGCGTGGGAAAAGGTT
GGCGTGCAGTTCACCGACGATGTGACACCCTATGAAGAGATGAAGATCGGCTTGCTCAAC
GGCAGCCACCTGGCCCTGACCTACCTGGGTTTTCTCAAGGGCTATCGGTTTGTGCACGAG
ACCATGAACGACCCGCTGTTCGTGGCCTACATGCGCGCCTACATGGACCTCGACGTCACG
CCAAACCTCGCGCCGGTACCGGGCATCGACCTGACCGACTACAAGCAGACCCTGGTGGAC
CGCTTCTCCAACCAGGCGATTGCCGACCAGTTGGAACGGGTGTGTTCGGATGGCTCGTCG
AAGTTTCCCAAGTTCACCGTGCCGACCATCAACCGCCTGATTGCCGACGGCCGTGAGACC
GAGCGTGCAGCACTGGTCGTCGCGGCCTGGGCCTTGTATTTGAAGGGTGTGGATGAGAAT
GGCGTGAGCTACACAATCCCCGATCCGCGCGCCGAGTTCTGCCAGGGGCTGGTGAGTGAC
GATGCACTGATCAGCCAGCGGTTGCTGGCAGTGGAAGAGATTTTCGGTACGGCTATTCCC
AACTCGCCTGAGTTTGTGGCAGCGTTCGAGCGGTGCTATGGGAGCCTGCGTGATAACGGC
GTCACCACTACCCTGAAGCACCTCCTGAAGAAACCGGTTTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDO08355
UniProtKB Entry NameO08355_PSEFL
GenBank Gene IDAF007800
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00742Mannitolapproved, investigationalunknownsubstrateDetails