Solute carrier family 22 member 2

Details

Name
Solute carrier family 22 member 2
Synonyms
  • hOCT2
  • OCT2
  • Organic cation transporter 2
Gene Name
SLC22A2
Organism
Human
Amino acid sequence
>lcl|BSEQ0037250|Solute carrier family 22 member 2
MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHRCRSPGVAELS
LRCGWSPAEELNYTVPGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLDTNRSRLPLG
PCRDGWVYETPGSSIVTEFNLVCANSWMLDLFQSSVNVGFFIGSMSIGYIADRFGRKLCL
LTTVLINAAAGVLMAISPTYTWMLIFRLIQGLVSKAGWLIGYILITEFVGRRYRRTVGIF
YQVAYTVGLLVLAGVAYALPHWRWLQFTVSLPNFFFLLYYWCIPESPRWLISQNKNAEAM
RIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIRKHTMILMYNWFTSSV
LYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFMIILTIDRIGRRYPWAASNMVAGAACLA
SVFIPGDLQWLKIIISCLGRMGITMAYEIVCLVNAELYPTFIRNLGVHICSSMCDIGGII
TPFLVYRLTNIWLELPLMVFGVLGLVAGGLVLLLPETKGKALPETIEEAENMQRPRKNKE
KMIYLQVQKLDIPLN
Number of residues
555
Molecular Weight
62579.99
Theoretical pI
8.45
GO Classification
Functions
dopamine transmembrane transporter activity / choline transmembrane transporter activity / quaternary ammonium group transmembrane transporter activity / organic cation transmembrane transporter activity
Processes
dopamine transport / neurotransmitter biosynthetic process / synaptic transmission / neurotransmitter secretion / ammonium transmembrane transport / small molecule metabolic process / body fluid secretion / organic cation transport / transmembrane transport / choline transport / drug transmembrane transport / quaternary ammonium group transport
Components
membrane / plasma membrane / extracellular exosome / integral component of plasma membrane
General Function
Quaternary ammonium group transmembrane transporter activity
Specific Function
Mediates tubular uptake of organic compounds from circulation. Mediates the influx of agmatine, dopamine, noradrenaline (norepinephrine), serotonin, choline, famotidine, ranitidine, histamin, creatinine, amantadine, memantine, acriflavine, 4-[4-(dimethylamino)-styryl]-N-methylpyridinium ASP, amiloride, metformin, N-1-methylnicotinamide (NMN), tetraethylammonium (TEA), 1-methyl-4-phenylpyridinium (MPP), cimetidine, cisplatin and oxaliplatin. Cisplatin may develop a nephrotoxic action. Transport of creatinine is inhibited by fluoroquinolones such as DX-619 and LVFX. This transporter is a major determinant of the anticancer activity of oxaliplatin and may contribute to antitumor specificity.
Pfam Domain Function
Transmembrane Regions
23-43 151-171 178-198 209-229 239-259 264-284 349-369 376-396 415-435 442-462 465-485 495-515
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0012536|Solute carrier family 22 member 2 (SLC22A2)
ATGCCCACCACCGTGGACGATGTCCTGGAGCATGGAGGGGAGTTTCACTTTTTCCAGAAG
CAAATGTTTTTCCTCTTGGCTCTGCTCTCGGCTACCTTCGCGCCCATCTACGTGGGCATC
GTCTTCCTGGGCTTCACCCCTGACCACCGCTGCCGGAGCCCCGGAGTGGCCGAGCTGAGT
CTGCGCTGCGGCTGGAGTCCTGCAGAGGAACTGAACTACACGGTGCCGGGCCCAGGACCT
GCGGGCGAAGCCTCCCCAAGACAGTGTAGGCGCTACGAGGTGGACTGGAACCAGAGCACC
TTCGACTGCGTGGACCCCCTGGCCAGCCTGGACACCAACAGGAGCCGCCTGCCACTGGGC
CCCTGCCGGGACGGCTGGGTGTACGAGACGCCTGGCTCGTCCATCGTCACCGAGTTTAAC
CTGGTATGTGCCAACTCCTGGATGTTGGACCTATTCCAGTCATCAGTGAATGTAGGATTC
TTTATTGGCTCTATGAGTATCGGCTACATAGCAGACAGGTTTGGCCGTAAGCTCTGCCTC
CTAACTACAGTCCTCATAAATGCTGCAGCTGGAGTTCTCATGGCCATTTCCCCAACCTAT
ACGTGGATGTTAATTTTTCGCTTAATCCAAGGACTGGTCAGCAAAGCAGGCTGGTTAATA
GGCTACATCCTGATTACAGAATTTGTTGGGCGGAGATATCGGAGAACAGTGGGGATTTTT
TACCAAGTTGCCTATACAGTTGGGCTCCTGGTGCTAGCTGGGGTGGCTTACGCACTTCCT
CACTGGAGGTGGTTGCAGTTCACAGTTTCTCTGCCCAACTTCTTCTTCTTGCTCTATTAC
TGGTGCATACCTGAGTCTCCCAGGTGGCTGATCTCCCAGAATAAGAATGCTGAAGCCATG
AGAATCATTAAGCACATCGCAAAGAAAAATGGAAAATCTCTACCCGCCTCCCTTCAGCGC
CTGAGACTTGAAGAGGAAACTGGCAAGAAATTGAACCCTTCATTTCTTGACTTGGTCAGA
ACTCCTCAGATAAGGAAACATACTATGATATTGATGTACAACTGGTTCACGAGCTCTGTG
CTCTACCAGGGCCTCATCATGCACATGGGCCTTGCAGGTGACAATATCTACCTGGATTTC
TTCTACTCTGCCCTGGTTGAATTCCCAGCTGCCTTCATGATCATCCTCACCATCGACCGC
ATCGGACGCCGTTACCCTTGGGCTGCATCAAATATGGTTGCAGGGGCAGCCTGTCTGGCC
TCAGTTTTTATACCTGGTGATCTACAATGGCTAAAAATTATTATCTCATGCTTGGGAAGA
ATGGGGATCACAATGGCCTATGAGATAGTCTGCCTGGTCAATGCTGAGCTGTACCCCACA
TTCATTAGGAATCTTGGCGTCCACATCTGTTCCTCAATGTGTGACATTGGTGGCATCATC
ACGCCATTCCTGGTCTACCGGCTCACTAACATCTGGCTTGAGCTCCCGCTGATGGTTTTC
GGCGTGCTTGGCTTGGTTGCTGGAGGTCTGGTGCTGTTGCTTCCAGAAACTAAAGGGAAA
GCTTTGCCTGAGACCATCGAGGAAGCCGAAAATATGCAAAGACCAAGAAAAAATAAAGAA
AAGATGATTTACCTCCAAGTTCAGAAACTAGACATTCCATTGAACTAA
Chromosome Location
6
Locus
6q26
External Identifiers
ResourceLink
UniProtKB IDO15244
UniProtKB Entry NameS22A2_HUMAN
GenBank Protein ID2281942
GenBank Gene IDX98333
HGNC IDHGNC:10966
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00571Propranololapproved, investigationalunknowninhibitorDetails
DB01580OxprenololapprovedunknowninhibitorDetails
DB00264Metoprololapproved, investigationalunknowninhibitorDetails
DB00468QuinineapprovedunknowninhibitorDetails
DB00122Cholineapproved, nutraceuticalunknownsubstrateinhibitorDetails
DB00917DinoprostoneapprovedunknowninhibitorDetails
DB00152Thiamineapproved, nutraceutical, vet_approvedunknowninhibitorDetails
DB00908QuinidineapprovedunknowninhibitorDetails
DB01035ProcainamideapprovedunknowninhibitorDetails
DB00368NorepinephrineapprovedunknownsubstrateinhibitorDetails
DB00184NicotineapprovedunknowninhibitorDetails
DB01137Levofloxacinapproved, investigationalunknowninhibitorDetails
DB00458ImipramineapprovedunknowninhibitorDetails
DB05381Histamineapproved, investigationalunknownsubstrateinhibitorDetails
DB00536GuanidineapprovedunknowninhibitorDetails
DB00365Grepafloxacininvestigational, withdrawnunknowninhibitorDetails
DB00988DopamineapprovedunknownsubstrateinhibitorDetails
DB00501CimetidineapprovedunknownsubstrateinhibitorDetails
DB00915AmantadineapprovedunknowninhibitorDetails
DB00396Progesteroneapproved, vet_approvedunknowninhibitorDetails
DB00457PrazosinapprovedunknownsubstrateinhibitorDetails
DB00925PhenoxybenzamineapprovedunknowninhibitorDetails
DB00783Estradiolapproved, investigational, vet_approvedunknowninhibitorDetails
DB00914Phenforminapproved, investigational, withdrawnunknowninhibitorDetails
DB00331MetforminapprovedunknownsubstrateinhibitorDetails
DB01151DesipramineapprovedunknowninhibitorDetails
DB00927FamotidineapprovedunknowninhibitorDetails
DB01032ProbenecidapprovedunknowninhibitorDetails
DB00345Aminohippuric acidapproved, investigationalunknowninhibitorDetails
DB00907Cocaineapproved, illicitunknowninhibitorDetails
DB00515CisplatinapprovedunknownsubstrateinhibitorDetails
DB01103Quinacrineapproved, investigationalunknowninhibitorDetails
DB01114ChlorphenamineapprovedunknowninhibitorDetails
DB00594AmilorideapprovedunknowninhibitorDetails
DB00668Epinephrineapproved, vet_approvedunknownsubstrateinhibitorDetails
DB00280DisopyramideapprovedunknowninhibitorDetails
DB01075DiphenhydramineapprovedunknowninhibitorDetails
DB00619ImatinibapprovedunknowninhibitorDetails
DB05383PimagedineinvestigationalunknowninhibitorDetails
DB01043Memantineapproved, investigationalunknownsubstrateDetails
DB00413Pramipexoleapproved, investigationalunknownsubstrateDetails
DB00206Reserpineapproved, investigationalunknownsubstrateDetails
DB00570VinblastineapprovedunknownsubstrateDetails
DB00694DaunorubicinapprovedunknownsubstrateDetails
DB00987Cytarabineapproved, investigationalunknownsubstrateDetails
DB00242Cladribineapproved, investigationalunknownsubstrateDetails
DB00526Oxaliplatinapproved, investigationalunknownsubstrateDetails
DB08837Tetraethylammoniumexperimental, investigationalunknownDetails
DB00495ZidovudineapprovedunknownDetails
DB08838Agmatineexperimental, investigationalunknownsubstrateDetails
DB01199TubocurarineapprovedunknownDetails
DB01337PancuroniumapprovedunknownDetails
DB01160Dinoprost Tromethamineapproved, vet_approvedunknownDetails
DB00690Flurazepamapproved, illicitunknowninhibitorDetails
DB00709Lamivudineapproved, investigationalunknownsubstrateDetails
DB09555Dexchlorpheniramine maleateapprovedunknowninhibitorDetails
DB12598Nafamostatapproved, investigationalunknownsubstrateDetails
DB13874EnasidenibapprovedunknowninhibitorDetails
DB09343TipiracilapprovednocarrierDetails
DB08930DolutegravirapprovednoinhibitorDetails
DB11817Baricitinibapproved, investigationalunknowninhibitorDetails