Solute carrier family 22 member 1

Details

Name
Solute carrier family 22 member 1
Synonyms
  • hOCT1
  • OCT1
  • Organic cation transporter 1
Gene Name
SLC22A1
Organism
Human
Amino acid sequence
>lcl|BSEQ0037862|Solute carrier family 22 member 1
MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQ
RCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGP
CQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLL
GTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMY
QMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIK
IMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVL
YQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVM
IFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIIT
PFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKEN
TIYLKVQTSEPSGT
Number of residues
554
Molecular Weight
61153.345
Theoretical pI
6.81
GO Classification
Functions
dopamine transmembrane transporter activity / secondary active organic cation transmembrane transporter activity / quaternary ammonium group transmembrane transporter activity / organic cation transmembrane transporter activity / acetylcholine transmembrane transporter activity / norepinephrine transmembrane transporter activity
Processes
epinephrine transport / establishment or maintenance of transmembrane electrochemical gradient / neurotransmitter transport / protein homooligomerization / norepinephrine transport / small molecule metabolic process / ammonium transmembrane transport / transmembrane transport / organic cation transport / drug transmembrane transport / quaternary ammonium group transport / dopamine transport
Components
membrane / plasma membrane / integral component of plasma membrane / basolateral plasma membrane
General Function
Secondary active organic cation transmembrane transporter activity
Specific Function
Translocates a broad array of organic cations with various structures and molecular weights including the model compounds 1-methyl-4-phenylpyridinium (MPP), tetraethylammonium (TEA), N-1-methylnicotinamide (NMN), 4-(4-(dimethylamino)styryl)-N-methylpyridinium (ASP), the endogenous compounds choline, guanidine, histamine, epinephrine, adrenaline, noradrenaline and dopamine, and the drugs quinine, and metformin. The transport of organic cations is inhibited by a broad array of compounds like tetramethylammonium (TMA), cocaine, lidocaine, NMDA receptor antagonists, atropine, prazosin, cimetidine, TEA and NMN, guanidine, cimetidine, choline, procainamide, quinine, tetrabutylammonium, and tetrapentylammonium. Translocates organic cations in an electrogenic and pH-independent manner. Translocates organic cations across the plasma membrane in both directions. Transports the polyamines spermine and spermidine. Transports pramipexole across the basolateral membrane of the proximal tubular epithelial cells. The choline transport is activated by MMTS. Regulated by various intracellular signaling pathways including inhibition by protein kinase A activation, and endogenously activation by the calmodulin complex, the calmodulin-dependent kinase II and LCK tyrosine kinase.
Pfam Domain Function
Transmembrane Regions
22-42 150-170 177-197 207-229 236-256 263-283 348-368 377-397 403-423 432-452 465-485 493-513
Cellular Location
Basolateral cell membrane
Gene sequence
>lcl|BSEQ0017170|Solute carrier family 22 member 1 (SLC22A1)
ATGCCCACCGTGGATGACATTCTGGAGCAGGTTGGGGAGTCTGGCTGGTTCCAGAAGCAA
GCCTTCCTCATCTTATGCCTGCTGTCGGCTGCCTTTGCGCCCATCTGTGTGGGCATCGTC
TTCCTGGGTTTCACACCTGACCACCACTGCCAGAGTCCTGGGGTGGCTGAGCTGAGCCAG
CGCTGTGGCTGGAGCCCTGCGGAGGAGCTGAACTATACAGTGCCAGGCCTGGGGCCCGCG
GGCGAGGCCTTCCTTGGCCAGTGCAGGCGCTATGAAGTGGACTGGAACCAGAGCGCCCTC
AGCTGTGTAGACCCCCTGGCTAGCCTGGCCACCAACAGGAGCCACCTGCCGCTGGGTCCC
TGCCAGGATGGCTGGGTGTATGACACGCCCGGCTCTTCCATCGTCACTGAGTTCAACCTG
GTGTGTGCTGACTCCTGGAAGCTGGACCTCTTTCAGTCCTGTTTGAATGCGGGCTTCTTG
TTTGGCTCTCTCGGTGTTGGCTACTTTGCAGACAGGTTTGGCCGTAAGCTGTGTCTCCTG
GGAACTGTGCTGGTCAACGCGGTGTCGGGCGTGCTCATGGCCTTCTCGCCCAACTACATG
TCCATGCTGCTCTTCCGCCTGCTGCAGGGCCTGGTCAGCAAGGGCAACTGGATGGCTGGC
TACACCCTAATCACAGAATTTGTTGGCTCGGGCTCCAGAAGAACGGTGGCGATCATGTAC
CAGATGGCCTTCACGGTGGGGCTGGTGGCGCTTACCGGGCTGGCCTACGCCCTGCCTCAC
TGGCGCTGGCTGCAGCTGGCAGTCTCCCTGCCCACCTTCCTCTTCCTGCTCTACTACTGG
TGTGTGCCGGAGTCCCCTCGGTGGCTGTTATCACAAAAAAGAAACACTGAAGCAATAAAG
ATAATGGACCACATCGCTCAAAAGAATGGGAAGTTGCCTCCTGCTGATTTAAAGATGCTT
TCCCTCGAAGAGGATGTCACCGAAAAGCTGAGCCCTTCATTTGCAGACCTGTTCCGCACG
CCGCGCCTGAGGAAGCGCACCTTCATCCTGATGTACCTGTGGTTCACGGACTCTGTGCTC
TATCAGGGGCTCATCCTGCACATGGGCGCCACCAGCGGGAACCTCTACCTGGATTTCCTT
TACTCCGCTCTGGTCGAAATCCCGGGGGCCTTCATAGCCCTCATCACCATTGACCGCGTG
GGCCGCATCTACCCCATGGCCATGTCAAATTTGTTGGCGGGGGCAGCCTGCCTCGTCATG
ATTTTTATCTCACCTGACCTGCACTGGTTAAACATCATAATCATGTGTGTTGGCCGAATG
GGAATCACCATTGCAATACAAATGATCTGCCTGGTGAATGCTGAGCTGTACCCCACATTC
GTCAGGAACCTCGGAGTGATGGTGTGTTCCTCCCTGTGTGACATAGGTGGGATAATCACC
CCCTTCATAGTCTTCAGGCTGAGGGAGGTCTGGCAAGCCTTGCCCCTCATTTTGTTTGCG
GTGTTGGGCCTGCTTGCCGCGGGAGTGACGCTACTTCTTCCAGAGACCAAGGGGGTCGCT
TTGCCAGAGACCATGAAGGACGCCGAGAACCTTGGGAGAAAAGCAAAGCCCAAAGAAAAC
ACGATTTACCTTAAGGTCCAAACCTCAGAACCCTCGGGCACCTGA
Chromosome Location
6
Locus
6q26
External Identifiers
ResourceLink
UniProtKB IDO15245
UniProtKB Entry NameS22A1_HUMAN
GenBank Protein ID2511670
GenBank Gene IDX98332
HGNC IDHGNC:10963
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00728RocuroniumapprovedunknowninhibitorDetails
DB00908QuinidineapprovedunknownsubstrateinhibitorDetails
DB01004Ganciclovirapproved, investigationalunknowninhibitorDetails
DB00787AciclovirapprovedunknowninhibitorDetails
DB00917DinoprostoneapprovedunknowninhibitorDetails
DB00396Progesteroneapproved, vet_approvedunknowninhibitorDetails
DB00457PrazosinapprovedunknowninhibitorDetails
DB00925PhenoxybenzamineapprovedunknowninhibitorDetails
DB00783Estradiolapproved, investigational, vet_approvedunknowninhibitorDetails
DB00914Phenforminapproved, investigational, withdrawnunknownsubstrateinhibitorDetails
DB00331MetforminapprovedunknownsubstrateinhibitorDetails
DB00152Thiamineapproved, nutraceutical, vet_approvedunknowninhibitorDetails
DB00863RanitidineapprovedunknowninhibitorDetails
DB01035ProcainamideapprovedunknowninhibitorDetails
DB00184NicotineapprovedunknowninhibitorDetails
DB05381Histamineapproved, investigationalunknownsubstrateinhibitorDetails
DB00988DopamineapprovedunknownsubstrateinhibitorDetails
DB00406Gentian VioletapprovedunknowninhibitorDetails
DB00575ClonidineapprovedunknowninhibitorDetails
DB00122Cholineapproved, nutraceuticalunknownsubstrateinhibitorDetails
DB00477Chlorpromazineapproved, vet_approvedunknowninhibitorDetails
DB00915AmantadineapprovedunknowninhibitorDetails
DB00661VerapamilapprovedunknowninhibitorDetails
DB01339VecuroniumapprovedunknowninhibitorDetails
DB04485Deoxythymidineexperimental, investigationalunknowninhibitorDetails
DB04348Taurocholic AcidexperimentalunknowninhibitorDetails
DB00468QuinineapprovedunknownsubstrateinhibitorDetails
DB01337PancuroniumapprovedunknownsubstrateinhibitorDetails
DB00501CimetidineapprovedunknownsubstrateinhibitorDetails
DB00683Midazolamapproved, illicitunknowninhibitorDetails
DB00280DisopyramideapprovedunknowninhibitorDetails
DB01151DesipramineapprovedunknowninhibitorDetails
DB01193AcebutololapprovedunknowninhibitorDetails
DB00520CaspofunginapprovedunknowninhibitorDetails
DB00345Aminohippuric acidapproved, investigationalunknowninhibitorDetails
DB00536GuanidineapprovedunknowninhibitorDetails
DB01032ProbenecidapprovedunknowninhibitorDetails
DB00624Testosteroneapproved, investigationalunknowninhibitorDetails
DB01232Saquinavirapproved, investigationalunknowninhibitorDetails
DB00220NelfinavirapprovedunknowninhibitorDetails
DB00458ImipramineapprovedunknowninhibitorDetails
DB01075DiphenhydramineapprovedunknowninhibitorDetails
DB00594AmilorideapprovedunknowninhibitorDetails
DB01114ChlorphenamineapprovedunknowninhibitorDetails
DB00668Epinephrineapproved, vet_approvedunknownsubstrateinhibitorDetails
DB00224IndinavirapprovedunknowninhibitorDetails
DB00206Reserpineapproved, investigationalunknowninhibitorDetails
DB00619ImatinibapprovedunknownsubstrateinhibitorDetails
DB00368NorepinephrineapprovedunknownsubstrateDetails
DB03128AcetylcholineapprovedunknownsubstrateDetails
DB00127Spermineapproved, nutraceuticalunknownsubstrateDetails
DB03566SpermidineexperimentalunknownsubstrateDetails
DB01199TubocurarineapprovedunknownsubstrateDetails
DB04830Buformininvestigational, withdrawnunknownsubstrateDetails
DB00987Cytarabineapproved, investigationalunknownsubstrateDetails
DB00413Pramipexoleapproved, investigationalunknownsubstrateDetails
DB00242Cladribineapproved, investigationalunknownsubstrateDetails
DB00526Oxaliplatinapproved, investigationalunknownsubstrateDetails
DB01614Acepromazineapproved, vet_approvedunknowninhibitorDetails
DB01621Pipotiazineapproved, investigationalunknownDetails
DB04574Estrone sulfateapprovedunknowninhibitorDetails
DB01622ThioproperazineapprovedunknowninhibitorDetails
DB01623ThiothixeneapprovedunknownDetails
DB08837Tetraethylammoniumexperimental, investigationalunknownDetails
DB00654Latanoprostapproved, investigationalunknownDetails
DB08838Agmatineexperimental, investigationalunknownsubstrateDetails
DB00318Codeineapproved, illicitunknownsubstrateDetails
DB00709Lamivudineapproved, investigationalunknownsubstrateDetails
DB09555Dexchlorpheniramine maleateapprovedunknownsubstrateinhibitorDetails
DB12598Nafamostatapproved, investigationalunknownsubstrateDetails
DB11591BilastineapprovedunknowninhibitorDetails
DB12267BrigatinibapprovednoinhibitorDetails
DB12332Rucaparibapproved, investigationalunknowninhibitorDetails
DB11817Baricitinibapproved, investigationalunknowninhibitorDetails