Multidrug resistance-associated protein 4

Details

Name
Multidrug resistance-associated protein 4
Synonyms
  • ATP-binding cassette sub-family C member 4
  • MOAT-B
  • MRP/cMOAT-related ABC transporter
  • MRP4
  • Multi-specific organic anion transporter B
Gene Name
ABCC4
Organism
Human
Amino acid sequence
>lcl|BSEQ0037136|Multidrug resistance-associated protein 4
MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPEDRSQHLGEEL
QGFWDKEVLRAENDAQKPSLTRAIIKCYWKSYLVLGIFTLIEESAKVIQPIFLGKIINYF
ENYDPMDSVALNTAYAYATVLTFCTLILAILHHLYFYHVQCAGMRLRVAMCHMIYRKALR
LSNMAMGKTTTGQIVNLLSNDVNKFDQVTVFLHFLWAGPLQAIAVTALLWMEIGISCLAG
MAVLIILLPLQSCFGKLFSSLRSKTATFTDARIRTMNEVITGIRIIKMYAWEKSFSNLIT
NLRKKEISKILRSSCLRGMNLASFFSASKIIVFVTFTTYVLLGSVITASRVFVAVTLYGA
VRLTVTLFFPSAIERVSEAIVSIRRIQTFLLLDEISQRNRQLPSDGKKMVHVQDFTAFWD
KASETPTLQGLSFTVRPGELLAVVGPVGAGKSSLLSAVLGELAPSHGLVSVHGRIAYVSQ
QPWVFSGTLRSNILFGKKYEKERYEKVIKACALKKDLQLLEDGDLTVIGDRGTTLSGGQK
ARVNLARAVYQDADIYLLDDPLSAVDAEVSRHLFELCICQILHEKITILVTHQLQYLKAA
SQILILKDGKMVQKGTYTEFLKSGIDFGSLLKKDNEESEQPPVPGTPTLRNRTFSESSVW
SQQSSRPSLKDGALESQDTENVPVTLSEENRSEGKVGFQAYKNYFRAGAHWIVFIFLILL
NTAAQVAYVLQDWWLSYWANKQSMLNVTVNGGGNVTEKLDLNWYLGIYSGLTVATVLFGI
ARSLLVFYVLVNSSQTLHNKMFESILKAPVLFFDRNPIGRILNRFSKDIGHLDDLLPLTF
LDFIQTLLQVVGVVSVAVAVIPWIAIPLVPLGIIFIFLRRYFLETSRDVKRLESTTRSPV
FSHLSSSLQGLWTIRAYKAEERCQELFDAHQDLHSEAWFLFLTTSRWFAVRLDAICAMFV
IIVAFGSLILAKTLDAGQVGLALSYALTLMGMFQWCVRQSAEVENMMISVERVIEYTDLE
KEAPWEYQKRPPPAWPHEGVIIFDNVNFMYSPGGPLVLKHLTALIKSQEKVGIVGRTGAG
KSSLISALFRLSEPEGKIWIDKILTTEIGLHDLRKKMSIIPQEPVLFTGTMRKNLDPFNE
HTDEELWNALQEVQLKETIEDLPGKMDTELAESGSNFSVGQRQLVCLARAILRKNQILII
DEATANVDPRTDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYV
LLQNKESLFYKMVQQLGKAEAAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQPSTLTI
FETAL
Number of residues
1325
Molecular Weight
149525.33
Theoretical pI
8.39
GO Classification
Functions
15-hydroxyprostaglandin dehydrogenase (NAD+) activity / ATP binding / ATPase activity, coupled to transmembrane movement of substances
Processes
blood coagulation / platelet activation / transmembrane transport / oxidation-reduction process / platelet degranulation
Components
membrane / platelet dense granule membrane / plasma membrane / integral component of membrane / basolateral plasma membrane
General Function
Atpase activity, coupled to transmembrane movement of substances
Specific Function
May be an organic anion pump relevant to cellular detoxification.
Pfam Domain Function
Transmembrane Regions
93-113 136-156 207-227 228-248 328-348 351-371 440-460 710-730 771-791 836-856 858-878 954-974 977-997 1038-1058
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0010828|Multidrug resistance-associated protein 4 (ABCC4)
ATGCTGCCCGTGTACCAGGAGGTGAAGCCCAACCCGCTGCAGGACGCGAACCTCTGCTCA
CGCGTGTTCTTCTGGTGGCTCAATCCCTTGTTTAAAATTGGCCATAAACGGAGATTAGAG
GAAGATGATATGTATTCAGTGCTGCCAGAAGACCGCTCACAGCACCTTGGAGAGGAGTTG
CAAGGGTTCTGGGATAAAGAAGTTTTAAGAGCTGAGAATGACGCACAGAAGCCTTCTTTA
ACAAGAGCAATCATAAAGTGTTACTGGAAATCTTATTTAGTTTTGGGAATTTTTACGTTA
ATTGAGGAAAGTGCCAAAGTAATCCAGCCCATATTTTTGGGAAAAATTATTAATTATTTT
GAAAATTATGATCCCATGGATTCTGTGGCTTTGAACACAGCGTACGCCTATGCCACGGTG
CTGACTTTTTGCACGCTCATTTTGGCTATACTGCATCACTTATATTTTTATCACGTTCAG
TGTGCTGGGATGAGGTTACGAGTAGCCATGTGCCATATGATTTATCGGAAGGCACTTCGT
CTTAGTAACATGGCCATGGGGAAGACAACCACAGGCCAGATAGTCAATCTGCTGTCCAAT
GATGTGAACAAGTTTGATCAGGTGACAGTGTTCTTACACTTCCTGTGGGCAGGACCACTG
CAGGCGATTGCAGTGACTGCCCTACTCTGGATGGAGATAGGAATATCGTGCCTTGCTGGG
ATGGCAGTTCTAATCATTCTCCTGCCCTTGCAAAGCTGTTTTGGGAAGTTGTTCTCATCA
CTGAGGAGTAAAACTGCAACTTTCACGGATGCCAGGATCAGGACCATGAATGAAGTTATA
ACTGGTATAAGGATAATAAAAATGTACGCCTGGGAAAAGTCATTTTCAAATCTTATTACC
AATTTGAGAAAGAAGGAGATTTCCAAGATTCTGAGAAGTTCCTGCCTCAGAGGGATGAAT
TTGGCTTCATTTTTCAGTGCAAGCAAAATCATCGTGTTTGTGACCTTCACCACCTACGTG
CTCCTCGGCAGTGTGATCACAGCCAGCCGCGTGTTCGTGGCAGTGACGCTGTATGGGGCT
GTGCGGCTGACGGTTACCCTCTTCTTCCCCTCAGCCATTGAGAGGGTGTCAGAGGCAATC
GTCAGCATCCGAAGAATCCAGACCTTTTTGCTACTTGATGAGATATCACAGCGCAACCGT
CAGCTGCCGTCAGATGGTAAAAAGATGGTGCATGTGCAGGATTTTACTGCTTTTTGGGAT
AAGGCATCAGAGACCCCAACTCTACAAGGCCTTTCCTTTACTGTCAGACCTGGCGAATTG
TTAGCTGTGGTCGGCCCCGTGGGAGCAGGGAAGTCATCACTGTTAAGTGCCGTGCTCGGG
GAATTGGCCCCAAGTCACGGGCTGGTCAGCGTGCATGGAAGAATTGCCTATGTGTCTCAG
CAGCCCTGGGTGTTCTCGGGAACTCTGAGGAGTAATATTTTATTTGGGAAGAAATACGAA
AAGGAACGATATGAAAAAGTCATAAAGGCTTGTGCTCTGAAAAAGGATTTACAGCTGTTG
GAGGATGGTGATCTGACTGTGATAGGAGATCGGGGAACCACGCTGAGTGGAGGGCAGAAA
GCACGGGTAAACCTTGCAAGAGCAGTGTATCAAGATGCTGACATCTATCTCCTGGACGAT
CCTCTCAGTGCAGTAGATGCGGAAGTTAGCAGACACTTGTTCGAACTGTGTATTTGTCAA
ATTTTGCATGAGAAGATCACAATTTTAGTGACTCATCAGTTGCAGTACCTCAAAGCTGCA
AGTCAGATTCTGATATTGAAAGATGGTAAAATGGTGCAGAAGGGGACTTACACTGAGTTC
CTAAAATCTGGTATAGATTTTGGCTCCCTTTTAAAGAAGGATAATGAGGAAAGTGAACAA
CCTCCAGTTCCAGGAACTCCCACACTAAGGAATCGTACCTTCTCAGAGTCTTCGGTTTGG
TCTCAACAATCTTCTAGACCCTCCTTGAAAGATGGTGCTCTGGAGAGCCAAGATACAGAG
AATGTCCCAGTTACACTATCAGAGGAGAACCGTTCTGAAGGAAAAGTTGGTTTTCAGGCC
TATAAGAATTACTTCAGAGCTGGTGCTCACTGGATTGTCTTCATTTTCCTTATTCTCCTA
AACACTGCAGCTCAGGTTGCCTATGTGCTTCAAGATTGGTGGCTTTCATACTGGGCAAAC
AAACAAAGTATGCTAAATGTCACTGTAAATGGAGGAGGAAATGTAACCGAGAAGCTAGAT
CTTAACTGGTACTTAGGAATTTATTCAGGTTTAACTGTAGCTACCGTTCTTTTTGGCATA
GCAAGATCTCTATTGGTATTCTACGTCCTTGTTAACTCTTCACAAACTTTGCACAACAAA
ATGTTTGAGTCAATTCTGAAAGCTCCGGTATTATTCTTTGATAGAAATCCAATAGGAAGA
ATTTTAAATCGTTTCTCCAAAGACATTGGACACTTGGATGATTTGCTGCCGCTGACGTTT
TTAGATTTCATCCAGAGATGGGATCTCGCTGTGTTGTCCTGGCTGGTCTCAAACTCCTAG
Chromosome Location
13
Locus
13q32
External Identifiers
ResourceLink
UniProtKB IDO15439
UniProtKB Entry NameMRP4_HUMAN
GenBank Protein ID3335173
GenBank Gene IDAF071202
GenAtlas IDABCC4
HGNC IDHGNC:55
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00563MethotrexateapprovedunknownsubstrateinhibitorDetails
DB02527Cyclic Adenosine MonophosphateexperimentalunknownsubstrateinhibitorDetails
DB01032Probenecidapproved, investigationalunknowninhibitorDetails
DB00975DipyridamoleapprovedunknowninhibitorDetails
DB00661VerapamilapprovedunknowninhibitorDetails
DB01138SulfinpyrazoneapprovedunknowninhibitorDetails
DB00203Sildenafilapproved, investigationalunknowninhibitorDetails
DB00158Folic Acidapproved, nutraceutical, vet_approvedunknowninhibitorDetails
DB04348Taurocholic AcidexperimentalunknowninhibitorDetails
DB00286Conjugated estrogensapprovedunknowninhibitorDetails
DB01586Ursodeoxycholic acidapproved, investigationalunknowninhibitorDetails
DB02659Cholic AcidapprovedunknowninhibitorDetails
DB00533Rofecoxibapproved, investigational, withdrawnunknowninhibitorDetails
DB01009Ketoprofenapproved, vet_approvedunknowninhibitorDetails
DB00328Indomethacinapproved, investigationalunknowninhibitorDetails
DB01050IbuprofenapprovedunknowninhibitorDetails
DB00712Flurbiprofenapproved, investigationalunknowninhibitorDetails
DB00586Diclofenacapproved, vet_approvedunknowninhibitorDetails
DB00482Celecoxibapproved, investigationalunknowninhibitorDetails
DB00352TioguanineapprovedunknowninhibitorDetails
DB00398Sorafenibapproved, investigationalunknowninhibitorDetails
DB01268Sunitinibapproved, investigationalunknowninhibitorDetails
DB01033MercaptopurineapprovedunknownsubstrateDetails
DB00143Glutathioneapproved, investigational, nutraceuticalunknownsubstrateDetails
DB00917DinoprostoneapprovedunknownsubstrateDetails
DB00770Alprostadilapproved, investigationalunknownsubstrateDetails
DB00718Adefovir Dipivoxilapproved, investigationalunknownsubstrateDetails
DB01076AtorvastatinapprovedunknownsubstrateDetails
DB01098RosuvastatinapprovedunknownsubstrateDetails
DB00198OseltamivirapprovedunknownsubstrateDetails
DB00814Meloxicamapproved, vet_approvedunknownsubstrateDetails
DB01327CefazolinapprovedunknownsubstrateDetails
DB00731Nateglinideapproved, investigationalunknownsubstrateDetails
DB08884Gadoxetic acidapprovedunknownsubstrateDetails
DB00495ZidovudineapprovedunknownsubstrateDetails
DB00544FluorouracilapprovedunknownsubstrateDetails
DB00709Lamivudineapproved, investigationalunknownsubstrateDetails
DB00300Tenofovir disoproxilapproved, investigationalunknownsubstrateDetails
DB00171ATPinvestigational, nutraceuticalunknownDetails
DB12332Rucaparibapproved, investigationalunknowninhibitorDetails
DB13146Fluciclovine (18F)approvednosubstrateDetails
DB09213Dexibuprofenapproved, investigationalunknownDetails