Voltage-dependent T-type calcium channel subunit alpha-1G

Details

Name
Voltage-dependent T-type calcium channel subunit alpha-1G
Synonyms
  • Cav3.1c
  • KIAA1123
  • NBR13
  • Voltage-gated calcium channel subunit alpha Cav3.1
Gene Name
CACNA1G
Organism
Human
Amino acid sequence
>lcl|BSEQ0000964|Voltage-dependent T-type calcium channel subunit alpha-1G
MDEEEDGAGAEESGQPRSFMRLNDLSGAGGRPGPGSAEKDPGSADSEAEGLPYPALAPVV
FFYLSQDSRPRSWCLRTVCNPWFERISMLVILLNCVTLGMFRPCEDIACDSQRCRILQAF
DDFIFAFFAVEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAGMLEYSLDLQNVSFSAVR
TVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNR
CFLPENFSLPLSVDLERYYQTENEDESPFICSQPRENGMRSCRSVPTLRGDGGGGPPCGL
DYEAYNSSSNTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQVITLEGWVDIM
YFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNA
STLASFSEPGSCYEELLKYLVYILRKAARRLAQVSRAAGVRVGLLSSPAPLGGQETQPSS
SCSRSHRRLSVHHLVHHHHHHHHHYHLGNGTLRAPRASPEIQDRDANGSRRLMLPPPSTP
ALSGAPPGGAESVHSFYHADCHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPE
TLKEKALVEVAASSGPPTLTSLNIPPGPYSSMHKLLETQSTGACQSSCKISSPCLKADSG
ACGPDSCPYCARAGAGEVELADREMPDSDSEAVYEFTQDAQHSDLRDPHSRRQRSLGPDA
EPSSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMGIEYHEQPEELTNALEISNI
VFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVISVWEIVGQQGGGLSVLRTFRLMR
VLKLVRFLPALQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASERDGDTL
PDRKNFDSLLWAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLLV
AILVEGFQAEEISKREDASGQLSCIQLPVDSQGGDANKSESEPDFFSPSLDGDGDRKKCL
ALVSLGEHPELRKSLLPPLIIHTAATPMSLPKSTSTGLGEALGPASRRTSSSGSAEPGAA
HEMKSPPSARSSPHSPWSAASSWTSRRSSRNSLGRAPSLKRRSPSGERRSLLSGEGQESQ
DEEESSEEERASPAGSDHRHRGSLEREAKSSFDLPDTLQVPGLHRTASGRGSASEHQDCN
GKSASGRLARALRPDDPPLDGDDADDEGNLSKGERVRAWIRARLPACCLERDSWSAYIFP
PQSRFRLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKIDPHSAERIFLTLSNYIFTAV
FLAEMTVKVVALGWCFGEQAYLRSSWNVLDGLLVLISVIDILVSMVSDSGTKILGMLRVL
RLLRTLRPLRVISRAQGLKLVVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFV
CQGEDTRNITNKSDCAEASYRWVRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVG
VDQQPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQEEEEARRREEKRL
RRLEKKRRNLMLDDVIASGSSASAASEAQCKPYYSDYSRFRLLVHHLCTSHYLDLFITGV
IGLNVVTMAMEHYQQPQILDEALKICNYIFTVIFVLESVFKLVAFGFRRFFQDRWNQLDL
AIVLLSIMGITLEEIEVNASLPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDTVMQAL
PQVGNLGLLFMLLFFIFAALGVELFGDLECDETHPCEGLGRHATFRNFGMAFLTLFRVST
GDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLEESNKE
AKEEAELEAELELEMKTLSPQPHSPLGSPFLWPGVEGPDSPDSPKPGALHPAAHARSASH
FSLEHPTDRQLFDTISLLIQGSLEWELKLMDELAGPGGQPSAFPSAPSLGGSDPQIPLAE
MEALSLTSEIVSEPSCSLALTDDSLPDDMHTLLLSALESNMQPHPTELPGPDLLTVRKSG
VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTSYILQLPKDAP
HLLQPHSAPTWGTIPKLPPPGRSPLAQRPLRRQAAIRTDSLDVQGLGSREDLLAEVSGPS
PPLARAYSFWGQSSTQAQQHSRSHSKISKHMTPPAPCPGPEPNWGKGPPETRSSLELDTE
LSWISGDLLPPGGQEEPPSPRDLKKCYSVEAQSCQRRPTSWLDEQRRHSIAVSCLDSGSQ
PHLGTDPSNLGGQPLGGPGSRPKKKLSPPSITIDPPESQGPRTPPSPGICLRRRAPSSDS
KDPLASGPPDSMAASPSPKKDVLSLSGLSSDPADLDP
Number of residues
2377
Molecular Weight
262468.62
Theoretical pI
6.57
GO Classification
Functions
low voltage-gated calcium channel activity / scaffold protein binding
Processes
transport / response to nickel cation / positive regulation of calcium ion-dependent exocytosis / synaptic transmission / axon guidance / membrane depolarization during action potential / regulation of atrial cardiac muscle cell membrane depolarization / regulation of heart rate / regulation of membrane potential / calcium ion import
Components
voltage-gated calcium channel complex / plasma membrane
General Function
Scaffold protein binding
Specific Function
Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1G gives rise to T-type calcium currents. T-type calcium channels belong to the "low-voltage activated (LVA)" group and are strongly blocked by mibefradil. A particularity of this type of channel is an opening at quite negative potentials and a voltage-dependent inactivation. T-type channels serve pacemaking functions in both central neurons and cardiac nodal cells and support calcium signaling in secretory cells and vascular smooth muscle. They may also be involved in the modulation of firing patterns of neurons which is important for information processing as well as in cell growth processes.
Pfam Domain Function
Transmembrane Regions
81-101 120-141 151-170 176-193 214-234 371-395 744-764 778-799 806-824 833-856 868-888 940-964 1273-1295 1314-1334 1345-1364 1379-1400 1411-1434 1512-1537 1611-1631 1646-1667 1675-1693 1708-1731 1746-1766 1827-1854
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0021643|Voltage-dependent T-type calcium channel subunit alpha-1G (CACNA1G)
ATGGACGAGGAGGAGGATGGAGCGGGCGCCGAGGAGTCGGGACAGCCCCGGAGCTTCATG
CGGCTCAACGACCTGTCGGGGGCCGGGGGCCGGCCGGGGCCGGGGTCAGCAGAAAAGGAC
CCGGGCAGCGCGGACTCCGAGGCGGAGGGGCTGCCGTACCCGGCGCTGGCCCCGGTGGTT
TTCTTCTACTTGAGCCAGGACAGCCGCCCGCGGAGCTGGTGTCTCCGCACGGTCTGTAAC
CCCTGGTTTGAGCGCATCAGCATGTTGGTCATCCTTCTCAACTGCGTGACCCTGGGCATG
TTCCGGCCATGCGAGGACATCGCCTGTGACTCCCAGCGCTGCCGGATCCTGCAGGCCTTT
GATGACTTCATCTTTGCCTTCTTTGCCGTGGAGATGGTGGTGAAGATGGTGGCCTTGGGC
ATCTTTGGGAAAAAGTGTTACCTGGGAGACACTTGGAACCGGCTTGACTTTTTCATCGTC
ATCGCAGGGATGCTGGAGTACTCGCTGGACCTGCAGAACGTCAGCTTCTCAGCTGTCAGG
ACAGTCCGTGTGCTGCGACCGCTCAGGGCCATTAACCGGGTGCCCAGCATGCGCATCCTT
GTCACGTTGCTGCTGGATACGCTGCCCATGCTGGGCAACGTCCTGCTGCTCTGCTTCTTC
GTCTTCTTCATCTTCGGCATCGTCGGCGTCCAGCTGTGGGCAGGGCTGCTTCGGAACCGA
TGCTTCCTACCTGAGAATTTCAGCCTCCCCCTGAGCGTGGACCTGGAGCGCTATTACCAG
ACAGAGAACGAGGATGAGAGCCCCTTCATCTGCTCCCAGCCACGCGAGAACGGCATGCGG
TCCTGCAGAAGCGTGCCCACGCTGCGCGGGGACGGGGGCGGTGGCCCACCTTGCGGTCTG
GACTATGAGGCCTACAACAGCTCCAGCAACACCACCTGTGTCAACTGGAACCAGTACTAC
ACCAACTGCTCAGCGGGGGAGCACAACCCCTTCAAGGGCGCCATCAACTTTGACAACATT
GGCTATGCCTGGATCGCCATCTTCCAGGTCATCACGCTGGAGGGCTGGGTCGACATCATG
TACTTTGTGATGGATGCTCATTCCTTCTACAATTTCATCTACTTCATCCTCCTCATCATC
GTGGGCTCCTTCTTCATGATCAACCTGTGCCTGGTGGTGATTGCCACGCAGTTCTCAGAG
ACCAAGCAGCGGGAAAGCCAGCTGATGCGGGAGCAGCGTGTGCGGTTCCTGTCCAACGCC
AGCACCCTGGCTAGCTTCTCTGAGCCCGGCAGCTGCTATGAGGAGCTGCTCAAGTACCTG
GTGTACATCCTTCGTAAGGCAGCCCGCAGGCTGGCTCAGGTCTCTCGGGCAGCAGGTGTG
CGGGTTGGGCTGCTCAGCAGCCCAGCACCCCTCGGGGGCCAGGAGACCCAGCCCAGCAGC
AGCTGCTCTCGCTCCCACCGCCGCCTATCCGTCCACCACCTGGTGCACCACCACCACCAC
CATCACCACCACTACCACCTGGGCAATGGGACGCTCAGGGCCCCCCGGGCCAGCCCGGAG
ATCCAGGACAGGGATGCCAATGGGTCCCGCCGGCTCATGCTGCCACCACCCTCGACGCCT
GCCCTCTCCGGGGCCCCCCCTGGTGGCGCAGAGTCTGTGCACAGCTTCTACCATGCCGAC
TGCCACTTAGAGCCAGTCCGCTGCCAGGCGCCCCCTCCCAGGTCCCCATCTGAGGCATCC
GGCAGGACTGTGGGCAGCGGGAAGGTGTATCCCACCGTGCACACCAGCCCTCCACCGGAG
ACGCTGAAGGAGAAGGCACTAGTAGAGGTGGCTGCCAGCTCTGGGCCCCCAACCCTCACC
AGCCTCAACATCCCACCCGGGCCCTACAGCTCCATGCACAAGCTGCTGGAGACACAGAGT
ACAGGTGCCTGCCAAAGCTCTTGCAAGATCTCCAGCCCTTGCTTGAAAGCAGACAGTGGA
GCCTGTGGTCCAGACAGCTGCCCCTACTGTGCCCGGGCCGGGGCAGGGGAGGTGGAGCTC
GCCGACCGTGAAATGCCTGACTCAGACAGCGAGGCAGTTTATGAGTTCACACAGGATGCC
CAGCACAGCGACCTCCGGGACCCCCACAGCCGGCGGCAACGGAGCCTGGGCCCAGATGCA
GAGCCCAGCTCTGTGCTGGCCTTCTGGAGGCTAATCTGTGACACCTTCCGAAAGATTGTG
GACAGCAAGTACTTTGGCCGGGGAATCATGATCGCCATCCTGGTCAACACACTCAGCATG
GGCATCGAATACCACGAGCAGCCCGAGGAGCTTACCAACGCCCTAGAAATCAGCAACATC
GTCTTCACCAGCCTCTTTGCCCTGGAGATGCTGCTGAAGCTGCTTGTGTATGGTCCCTTT
GGCTACATCAAGAATCCCTACAACATCTTCGATGGTGTCATTGTGGTCATCAGCGTGTGG
GAGATCGTGGGCCAGCAGGGGGGCGGCCTGTCGGTGCTGCGGACCTTCCGCCTGATGCGT
GTGCTGAAGCTGGTGCGCTTCCTGCCGGCGCTGCAGCGGCAGCTGGTGGTGCTCATGAAG
ACCATGGACAACGTGGCCACCTTCTGCATGCTGCTTATGCTCTTCATCTTCATCTTCAGC
ATCCTGGGCATGCATCTCTTCGGCTGCAAGTTTGCCTCTGAGCGGGATGGGGACACCCTG
CCAGACCGGAAGAATTTTGACTCCTTGCTCTGGGCCATCGTCACTGTCTTTCAGATCCTG
ACCCAGGAGGACTGGAACAAAGTCCTCTACAATGGTATGGCCTCCACGTCGTCCTGGGCG
GCCCTTTATTTCATTGCCCTCATGACCTTCGGCAACTACGTGCTCTTCAATTTGCTGGTC
GCCATTCTGGTGGAGGGCTTCCAGGCGGAGGAAATCAGCAAACGGGAAGATGCGAGTGGA
CAGTTAAGCTGTATTCAGCTGCCTGTCGACTCCCAGGGGGGAGATGCCAACAAGTCCGAA
TCAGAGCCCGATTTCTTCTCACCCAGCCTGGATGGTGATGGGGACAGGAAGAAGTGCTTG
GCCTTGGTGTCCCTGGGAGAGCACCCGGAGCTGCGGAAGAGCCTGCTGCCGCCTCTCATC
ATCCACACGGCCGCCACACCCATGTCGCTGCCCAAGAGCACCAGCACGGGCCTGGGCGAG
GCGCTGGGCCCTGCGTCGCGCCGCACCAGCAGCAGCGGGTCGGCAGAGCCTGGGGCGGCC
CACGAGATGAAGTCACCGCCCAGCGCCCGCAGCTCTCCGCACAGCCCCTGGAGCGCTGCA
AGCAGCTGGACCAGCAGGCGCTCCAGCCGGAACAGCCTCGGCCGTGCACCCAGCCTGAAG
CGGAGAAGCCCAAGTGGAGAGCGGCGGTCCCTGTTGTCGGGAGAAGGCCAGGAGAGCCAG
GATGAAGAGGAGAGCTCAGAAGAGGAGCGGGCCAGCCCTGCGGGCAGTGACCATCGCCAC
AGGGGGTCCCTGGAGCGGGAGGCCAAGAGTTCCTTTGACCTGCCAGACACACTGCAGGTG
CCAGGGCTGCATCGCACTGCCAGTGGCCGAGGGTCTGCTTCTGAGCACCAGGACTGCAAT
GGCAAGTCGGCTTCAGGGCGCCTGGCCCGGGCCCTGCGGCCTGATGACCCCCCACTGGAT
GGGGATGACGCCGATGACGAGGGCAACCTGAGCAAAGGGGAACGGGTCCGCGCGTGGATC
CGAGCCCGACTCCCTGCCTGCTGCCTCGAGCGAGACTCCTGGTCAGCCTACATCTTCCCT
CCTCAGTCCAGGTTCCGCCTCCTGTGTCACCGGATCATCACCCACAAGATGTTCGACCAC
GTGGTCCTTGTCATCATCTTCCTTAACTGCATCACCATCGCCATGGAGCGCCCCAAAATT
GACCCCCACAGCGCTGAACGCATCTTCCTGACCCTCTCCAATTACATCTTCACCGCAGTC
TTTCTGGCTGAAATGACAGTGAAGGTGGTGGCACTGGGCTGGTGCTTCGGGGAGCAGGCG
TACCTGCGGAGCAGTTGGAACGTGCTGGACGGGCTGTTGGTGCTCATCTCCGTCATCGAC
ATTCTGGTGTCCATGGTCTCTGACAGCGGCACCAAGATCCTGGGCATGCTGAGGGTGCTG
CGGCTGCTGCGGACCCTGCGCCCGCTCAGGGTGATCAGCCGGGCGCAGGGGCTGAAGCTG
GTGGTGGAGACGCTGATGTCCTCACTGAAACCCATCGGCAACATTGTAGTCATCTGCTGT
GCCTTCTTCATCATTTTCGGCATCTTGGGGGTGCAGCTCTTCAAAGGGAAGTTTTTCGTG
TGCCAGGGCGAGGATACCAGGAACATCACCAATAAATCGGACTGTGCCGAGGCCAGTTAC
CGGTGGGTCCGGCACAAGTACAACTTTGACAACCTTGGCCAGGCCCTGATGTCCCTGTTC
GTTTTGGCCTCCAAGGATGGTTGGGTGGACATCATGTACGATGGGCTGGATGCTGTGGGC
GTGGACCAGCAGCCCATCATGAACCACAACCCCTGGATGCTGCTGTACTTCATCTCGTTC
CTGCTCATTGTGGCCTTCTTTGTCCTGAACATGTTTGTGGGTGTGGTGGTGGAGAACTTC
CACAAGTGTCGGCAGCACCAGGAGGAAGAGGAGGCCCGGCGGCGGGAGGAGAAGCGCCTA
CGAAGACTGGAGAAAAAGAGAAGGAAAGCCCAGTGCAAACCTTACTACTCCGACTACTCC
CGCTTCCGGCTCCTCGTCCACCACTTGTGCACCAGCCACTACCTGGACCTCTTCATCACA
GGTGTCATCGGGCTGAACGTGGTCACCATGGCCATGGAGCACTACCAGCAGCCCCAGATT
CTGGATGAGGCTCTGAAGATCTGCAACTACATCTTCACTGTCATCTTTGTCTTGGAGTCA
GTTTTCAAACTTGTGGCCTTTGGTTTCCGTCGGTTCTTCCAGGACAGGTGGAACCAGCTG
GACCTGGCCATTGTGCTGCTGTCCATCATGGGCATCACGCTGGAGGAAATCGAGGTCAAC
GCCTCGCTGCCCATCAACCCCACCATCATCCGCATCATGAGGGTGCTGCGCATTGCCCGA
GTGCTGAAGCTGCTGAAGATGGCTGTGGGCATGCGGGCGCTGCTGGACACGGTGATGCAG
GCCCTGCCCCAGGTGGGGAACCTGGGACTTCTCTTCATGTTGTTGTTTTTCATCTTTGCA
GCTCTGGGCGTGGAGCTCTTTGGAGACCTGGAGTGTGACGAGACACACCCCTGTGAGGGC
CTGGGCCGTCATGCCACCTTTCGGAACTTTGGCATGGCCTTCCTAACCCTCTTCCGAGTC
TCCACAGGTGACAATTGGAATGGCATTATGAAGGACACCCTCCGGGACTGTGACCAGGAG
TCCACCTGCTACAACACGGTCATCTCGCCTATCTACTTTGTGTCCTTCGTGCTGACGGCC
CAGTTCGTGCTAGTCAACGTGGTGATCGCCGTGCTGATGAAGCACCTGGAGGAGAGCAAC
AAGGAGGCCAAGGAGGAGGCCGAGCTAGAGGCTGAGCTGGAGCTGGAGATGAAGACCCTC
AGCCCCCAGCCCCACTCGCCACTGGGCAGCCCCTTCCTCTGGCCTGGGGTCGAGGGCCCC
GACAGCCCCGACAGCCCCAAGCCTGGGGCTCTGCACCCAGCGGCCCACGCGAGATCAGCC
TCCCACTTTTCCCTGGAGCACCCCACGGACAGGCAGCTGTTTGACACCATATCCCTGCTG
ATCCAGGGCTCCCTGGAGTGGGAGCTGAAGCTGATGGACGAGCTGGCAGGCCCAGGGGGC
CAGCCCTCTGCCTTCCCTTCTGCCCCCAGCCTGGGAGGCTCCGACCCACAGATGCAGCCC
CACCCCACGGAGCTGCCAGGACCAGACTTACTGACTGTGCGGAAGTCTGGGGTCAGCCGA
ACGCACTCTCTGCCCAATGACAGCTACATGTGTCGGCATGGGAGCACTGCCGAGGGGCCC
CTGGGACACAGGGGCTGGGGGCTCCCCAAAGCTCAGTCAGGCTCCGTCTTGTCCGTTCAC
TCCCAGCCAGCAGATACCAGCTACATCCTGCAGCTTCCCAAAGATGCACCTCATCTGCTC
CAGCCCCACAGCGCCCCAACCTGGGGCACCATCCCCAAACTGCCCCCACCAGGACGCTCC
CCTTTGGCTCAGAGGCCACTCAGGCGCCAGGCAGCAATAAGGACTGACTCCTTGGACGTT
CAGGGTCTGGGCAGCCGGGAAGACCTGCTGGCAGAGGTGAGTGGGCCCTCCCCGCCCCTG
GCCCGGGCCTACTCTTTCTGGGGCCAGTCAAGTACCCAGGCACAGCAGCACTCCCGCAGC
CACAGCAAGATCTCCAAGCACATGACCCCGCCAGCCCCTTGCCCAGGCCCAGAACCCAAC
TGGGGCAAGGGCCCTCCAGAGACCAGAAGCAGCTTAGAGTTGGACACGGAGCTGAGCTGG
ATTTCAGGAGACCTCCTGCCCCCTGGCGGCCAGGAGGAGCCCCCATCCCCACGGGACCTG
AAGAAGTGCTACAGCGTGGAGGCCCAGAGCTGCCAGCGCCGGCCTACGTCCTGGCTGGAT
GAGCAGAGGAGACACTCTATCGCCGTCAGCTGCCTGGACAGCGGCTCCCAACCCCACCTG
GGCACAGACCCCTCTAACCTTGGGGGCCAGCCTCTTGGGGGGCCTGGGAGCCGGCCCAAG
AAAAAACTCAGCCCGCCTAGTATCACCATAGACCCCCCCGAGAGCCAAGGTCCTCGGACC
CCGCCCAGCCCTGGTATCTGCCTCCGGAGGAGGGCTCCGTCCAGCGACTCCAAGGATCCC
TTGGCCTCTGGCCCCCCTGACAGCATGGCTGCCTCGCCCTCCCCAAAGAAAGATGTGCTG
AGTCTCTCCGGTTTATCCTCTGACCCAGCAGACCTGGACCCCTGA
Chromosome Location
17
Locus
17q22
External Identifiers
ResourceLink
UniProtKB IDO43497
UniProtKB Entry NameCAC1G_HUMAN
GenBank Protein ID6625659
GenBank Gene IDAF134986
GenAtlas IDCACNA1G
HGNC IDHGNC:1394
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00347TrimethadioneapprovedyesinhibitorDetails
DB00593EthosuximideapprovedyesinhibitorDetails
DB00909Zonisamideapproved, investigationalyesinhibitorDetails
DB01388Mibefradilinvestigational, withdrawnyesinhibitorDetails
DB04841FlunarizineapprovedyesinhibitorDetails
DB00661VerapamilapprovedunknowninhibitorDetails
DB00568Cinnarizineapproved, investigationalyesinhibitorDetails
DB05246MethsuximideapprovedyesinhibitorDetails
DB09061Cannabidiolapproved, investigationalunknownDetails
DB14011Nabiximolsapproved, investigationalunknownDetails
DB14009Medical Cannabisexperimental, investigationalunknownDetails
DB00421SpironolactoneapprovedunknowninhibitorDetails
DB11148Butambenapproved, withdrawnyesinhibitorDetails
DB11093Calcium CitrateapprovedunknownsubstrateDetails
DB11348Calcium PhosphateapprovedunknownsubstrateDetails
DB09089TrimebutineapprovedunknownactivatorDetails
DB09238Manidipineapproved, investigationalyesblockerDetails
DB09231Benidipineapproved, investigationalyesantagonistDetails
DB13746Bioallethrinapproved, experimentalunknownblockerDetails
DB14481Calcium phosphate dihydrateapprovedunknownDetails