Glutamate receptor ionotropic, NMDA 3B

Details

Name
Glutamate receptor ionotropic, NMDA 3B
Synonyms
  • GluN3B
  • N-methyl-D-aspartate receptor subtype 3B
  • NMDAR3B
  • NR3B
Gene Name
GRIN3B
Organism
Human
Amino acid sequence
>lcl|BSEQ0001066|Glutamate receptor ionotropic, NMDA 3B
MEFVRALWLGLALALGPGSAGGHPQPCGVLARLGGSVRLGALLPRAPLARARARAALARA
ALAPRLPHNLSLELVVAAPPARDPASLTRGLCQALVPPGVAALLAFPEARPELLQLHFLA
AATETPVLSLLRREARAPLGAPNPFHLQLHWASPLETLLDVLVAVLQAHAWEDVGLALCR
TQDPGGLVALWTSRAGRPPQLVLDLSRRDTGDAGLRARLAPMAAPVGGEAPVPAAVLLGC
DIARARRVLEAVPPGPHWLLGTPLPPKALPTAGLPPGLLALGEVARPPLEAAIHDIVQLV
ARALGSAAQVQPKRALLPAPVNCGDLQPAGPESPGRFLARFLANTSFQGRTGPVWVTGSS
QVHMSRHFKVWSLRRDPRGAPAWATVGSWRDGQLDLEPGGASARPPPPQGAQVWPKLRVV
TLLEHPFVFARDPDEDGQCPAGQLCLDPGTNDSATLDALFAALANGSAPRALRKCCYGYC
IDLLERLAEDTPFDFELYLVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQ
VVDFTSPFFSTSLGIMVRARDTASPIGAFMWPLHWSTWLGVFAALHLTALFLTVYEWRSP
YGLTPRGRNRSTVFSYSSALNLCYAILFRRTVSSKTPKCPTGRLLMNLWAIFCLLVLSSY
TANLAAVMVGDKTFEELSGIHDPKLHHPAQGFRFGTVWESSAEAYIKKSFPDMHAHMRRH
SAPTTPRGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQN
SPLTSNLSEFISRYKSSGFIDLLHDKWYKMVPCGKRVFAVTETLQMSIYHFAGLFVLLCL
GLGSALLSSLGEHAFFRLALPRIRKGSRLQYWLHTSQKIHRALNTEPPEGSKEETAEAEP
SGPEVEQQQQQQDQPTAPEGWKRARRAVDKERRVRFLLEPAVVVAPEADAEAEAAPREGP
VWLCSYGRPPAARPTGAPQPGELQELERRIEVARERLRQALVRRGQLLAQLGDSARHRPR
RLLQARAAPAEAPPHSGRPGSQE
Number of residues
1043
Molecular Weight
112990.98
Theoretical pI
9.5
GO Classification
Functions
cation channel activity / extracellular-glutamate-gated ion channel activity / neurotransmitter receptor activity / NMDA glutamate receptor activity / calcium channel activity / neurotransmitter binding / glycine binding
Processes
synaptic transmission, glutamatergic / ionotropic glutamate receptor signaling pathway / ion transmembrane transport / protein insertion into membrane / regulation of calcium ion transport
Components
postsynaptic membrane / NMDA selective glutamate receptor complex / plasma membrane / cell junction / dendrite / neuronal cell body
General Function
Nmda glutamate receptor activity
Specific Function
NMDA receptor subtype of glutamate-gated ion channels with reduced single-channel conductance, low calcium permeability and low voltage-dependent sensitivity to magnesium. Mediated by glycine.
Pfam Domain Function
Transmembrane Regions
565-585 649-669 831-851
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0016125|Glutamate receptor ionotropic, NMDA 3B (GRIN3B)
ATGGAGTTTGTGCGGGCGCTGTGGCTGGGCCTGGCGCTGGCGCTGGGGCCGGGGTCCGCG
GGGGGCCACCCTCAGCCGTGCGGCGTCCTGGCGCGCCTCGGGGGCTCCGTGCGCCTGGGC
GCCCTCCTGCCCCGCGCGCCTCTCGCCCGCGCCCGCGCCCGCGCCGCCCTGGCCCGGGCC
GCCCTGGCGCCGCGGCTGCCGCACAACCTGAGCTTGGAGCTGGTGGTCGCCGCGCCCCCC
GCCCGCGACCCCGCCTCGCTGACCCGCGGCCTGTGCCAGGCGCTGGTGCCTCCGGGCGTG
GCGGCCCTGCTCGCCTTTCCCGAGGCTCGGCCCGAGCTGCTGCAGCTGCACTTCCTGGCG
GCGGCCACCGAGACCCCCGTGCTCAGCCTGCTGCGGCGGGAGGCGCGCGCGCCCCTCGGA
GCCCCGAACCCATTCCACCTGCAGCTGCACTGGGCCAGCCCCCTGGAGACGCTGCTGGAT
GTGCTGGTGGCGGTGCTGCAGGCGCACGCCTGGGAAGACGTCGGCCTGGCCCTGTGCCGC
ACTCAGGACCCCGGCGGCCTGGTGGCCCTCTGGACAAGCCGGGCTGGCCGGCCCCCACAG
CTGGTCCTGGACCTAAGCCGGCGGGACACGGGAGATGCAGGACTGCGGGCACGCCTGGCC
CCGATGGCGGCGCCAGTGGGGGGTGAAGCACCGGTACCCGCGGCGGTCCTCCTCGGCTGT
GACATCGCCCGTGCCCGTCGGGTGCTGGAGGCCGTACCTCCCGGCCCCCACTGGCTGTTG
GGGACACCACTGCCGCCCAAGGCCCTGCCCACCGCGGGGCTGCCACCAGGGCTGCTGGCG
CTGGGCGAGGTGGCACGACCCCCGCTGGAGGCCGCCATCCATGACATTGTGCAACTGGTG
GCCCGGGCGCTGGGCAGTGCGGCCCAGGTGCAGCCGAAGCGAGCCCTCCTCCCCGCCCCG
GTCAACTGCGGGGACCTGCAGCCGGCCGGGCCCGAGTCCCCGGGGCGCTTCTTGGCACGG
TTCCTGGCCAACACGTCCTTCCAGGGCCGCACGGGCCCCGTGTGGGTGACAGGCAGCTCC
CAGGTACACATGTCTCGGCACTTTAAGGTGTGGAGCCTTCGCCGGGACCCACGGGGCGCC
CCGGCCTGGGCCACGGTGGGCAGCTGGCGGGACGGCCAGCTGGACTTGGAACCGGGAGGT
GCCTCTGCACGGCCCCCGCCCCCACAGGGTGCCCAGGTCTGGCCCAAGCTGCGTGTGGTA
ACGCTGTTGGAACACCCATTTGTGTTTGCCCGTGATCCAGACGAAGACGGGCAGTGCCCA
GCGGGGCAGCTGTGCCTGGACCCTGGCACCAACGACTCGGCCACCCTGGACGCACTGTTC
GCCGCGCTGGCCAACGGCTCAGCGCCCCGTGCCCTGCGCAAGTGCTGCTACGGCTACTGC
ATTGACCTGCTGGAGCGGCTGGCGGAGGACACGCCCTTCGACTTCGAGCTGTACCTCGTG
GGTGACGGCAAGTACGGCGCCCTGCGGGACGGCCGCTGGACCGGCCTGGTCGGGGACCTG
CTGGCCGGCCGGGCCCACATGGCGGTCACCAGCTTCAGTATCAACTCCGCCCGCTCACAG
GTGGTGGACTTCACCAGCCCCTTCTTCTCCACCAGCCTGGGCATCATGGTGCGGGCACGG
GACACGGCCTCACCCATCGGTGCCTTTATGTGGCCCCTGCACTGGTCCACGTGGCTGGGC
GTCTTTGCGGCCCTGCACCTCACCGCGCTCTTCCTCACCGTGTACGAGTGGCGTAGCCCC
TACGGCCTCACGCCACGTGGCCGCAACCGCAGCACCGTCTTCTCCTACTCCTCAGCCCTC
AACCTGTGCTACGCCATCCTCTTCAGACGCACCGTGTCCAGCAAGACGCCCAAGTGCCCC
ACGGGCCGCCTGCTCATGAACCTCTGGGCCATCTTCTGCCTGCTGGTGCTGTCCAGCTAC
ACGGCCAACCTGGCTGCCGTCATGGTCGGGGACAAGACCTTCGAGGAGCTGTCGGGGATC
CACGACCCCAAGCTGCACCACCCGGCGCAGGGCTTCCGCTTCGGCACCGTGTGGGAGAGC
AGCGCCGAGGCGTACATCAAGAAGAGCTTCCCCGACATGCACGCACACATGCGGCGCCAC
AGCGCGCCCACCACGCCCCGCGGCGTCGCCATGCTCACGAGCGACCCCCCCAAGCTCAAC
GCCTTCATCATGGACAAGTCGCTCCTGGACTACGAGGTCTCCATCGACGCCGACTGCAAA
CTGCTGACCGTGGGAAAGCCCTTCGCCATTGAGGGCTATGGGATCGGACTGCCCCAGAAC
TCGCCGCTCACCTCCAACCTGTCCGAGTTCATCAGCCGCTACAAGTCCTCCGGCTTCATC
GACCTGCTCCACGACAAGTGGTACAAGATGGTGCCTTGCGGCAAGCGGGTCTTTGCGGTT
ACAGAGACCCTGCAGATGAGCATCTACCACTTCGCGGGCCTCTTCGTGTTGCTGTGCCTG
GGCCTGGGCAGCGCTCTGCTCAGCTCGCTGGGCGAGCACGCCTTCTTCCGCCTGGCGCTG
CCGCGCATCCGCAAGGGGAGCAGGCTGCAGTACTGGCTGCACACCAGCCAGAAAATCCAC
CGCGCCCTCAACACGGAGCCACCAGAGGGGTCGAAGGAGGAGACGGCAGAGGCGGAGCCC
AGCGGCCCCGAGGTGGAGCAGCAGCAGCAGCAGCAGGACCAGCCAACGGCTCCGGAGGGC
TGGAAACGGGCGCGCCGGGCCGTGGACAAGGAGCGCCGCGTGCGCTTCCTGCTGGAGCCC
GCCGTGGTTGTGGCACCCGAAGCGGACGCGGAGGCGGAGGCTGCGCCGCGAGAGGGCCCC
GTCTGGCTGTGCTCCTACGGCCGCCCGCCCGCCGCAAGGCCCACGGGGGCCCCCCAGCCC
GGGGAGCTGCAGGAGCTGGAGCGCCGCATCGAAGTCGCGCGTGAGCGGCTCCGCCAGGCC
CTGGTGCGGCGCGGCCAGCTCCTGGCACAGCTCGGGGACAGCGCACGTCACCGGCCTCGG
CGCTTGCTTCAGGCCAGAGCGGCCCCCGCGGAGGCCCCACCACACTCTGGCCGACCGGGG
AGCCAGGAATGA
Chromosome Location
19
Locus
19p13.3
External Identifiers
ResourceLink
UniProtKB IDO60391
UniProtKB Entry NameNMD3B_HUMAN
GenBank Protein ID3025446
GenBank Gene IDAC004528
GenAtlas IDGRIN3B
HGNC IDHGNC:16768
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01173OrphenadrineapprovedyesantagonistDetails
DB00145Glycineapproved, nutraceutical, vet_approvedunknownDetails
DB00142Glutamic Acidapproved, nutraceuticalunknownDetails
DB01520Tenocyclidineexperimental, illicit, investigationalyesantagonistDetails
DB01159Halothaneapproved, vet_approvedunknownantagonistDetails
DB00659Acamprosateapproved, investigationalyesantagonistDetails
DB06741GavestinelinvestigationalunknownantagonistDetails
DB09481Magnesium carbonateapproved, investigationalunknownblockerDetails
DB09409Magnesium acetate tetrahydrateapprovedunknownligandDetails
DB13146Fluciclovine (18F)approvednoinhibitorDetails
DB04896Milnacipranapproved, investigationalunknowninhibitorDetails
DB00289AtomoxetineapprovedunknownblockerDetails
DB00312Pentobarbitalapproved, investigational, vet_approvedunknownantagonistDetails
DB00418Secobarbitalapproved, vet_approvedunknownantagonistDetails
DB00996Gabapentinapproved, investigationalunknowninhibitorDetails
DB01174Phenobarbitalapproved, investigationalunknownantagonistDetails
DB01708Prasteroneapproved, investigational, nutraceuticalunknownagonistDetails
DB06738KetobemidoneexperimentalunknownantagonistDetails