Acetoin utilization protein

Details

Name
Acetoin utilization protein
Synonyms
Not Available
Gene Name
acuC1
Organism
Aquifex aeolicus (strain VF5)
Amino acid sequence
>lcl|BSEQ0022033|Acetoin utilization protein
MKKVKLIGTLDYGKYRYPKNHPLKIPRVSLLLRFLDAMNLIDEKELIKSRPATKEELLLF
HTEDYINTLMEAERCQCVPKGAREKYNIGGYENPVSYAMFTGSSLATGSTVQAIEEFLKG
NVAFNPAGGMHHAFKSRANGFCYINDPAVGIEYLRKKGFKRILYIDLDAHHCDGVQEAFY
DTDQVFVLSLHQSPEYAFPFEKGFLEEIGEGKGKGYNLNIPLPKGLNDNEFLFALEKSLE
IVKEVFEPEVYLLQLGTDPLLEDYLSKFNLSNVAFLKAFNIVREVFGEGVYLGGGGYHPY
ALARAWTLIWCELSGREVPEKLNNKAKELLKSIDFEEFDDEVDRSYMLETLKDPWRGGEV
RKEVKDTLEKAKASS
Number of residues
375
Molecular Weight
42662.46
Theoretical pI
5.53
GO Classification
Functions
metal ion binding
General Function
Metal ion binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0022034|Acetoin utilization protein (acuC1)
ATGAAGAAGGTTAAACTTATCGGAACTTTAGACTACGGAAAGTACAGATATCCCAAAAAC
CATCCTCTTAAAATACCAAGAGTTTCCCTACTCCTTAGGTTTTTAGATGCCATGAACCTT
ATAGATGAGAAGGAATTAATCAAGAGCAGACCCGCAACTAAAGAAGAACTCCTTTTATTC
CACACGGAAGACTACATAAACACTTTAATGGAAGCGGAAAGGTGTCAGTGCGTTCCGAAG
GGAGCTAGGGAAAAGTACAACATAGGCGGATACGAAAACCCCGTATCTTACGCGATGTTT
ACAGGCTCTTCTCTCGCAACGGGTTCAACAGTGCAGGCGATAGAGGAATTTTTAAAGGGA
AATGTAGCTTTCAATCCCGCGGGAGGTATGCACCACGCTTTTAAAAGCAGGGCAAACGGC
TTTTGCTACATAAACGACCCCGCTGTGGGAATTGAGTACTTGAGAAAAAAAGGCTTTAAG
AGAATACTCTACATAGACCTTGATGCCCACCACTGCGACGGTGTTCAGGAAGCCTTTTAC
GATACAGACCAGGTGTTCGTCCTGTCCCTTCACCAGTCGCCCGAGTACGCCTTTCCCTTT
GAGAAGGGCTTCCTGGAGGAGATAGGAGAAGGAAAAGGAAAGGGCTACAACCTGAACATT
CCCCTGCCAAAGGGCTTGAACGACAACGAGTTCCTCTTTGCCCTAGAAAAATCTCTGGAA
ATAGTCAAAGAAGTATTTGAGCCCGAGGTTTACCTTCTTCAACTCGGAACTGACCCACTC
CTTGAAGATTACCTTTCCAAGTTCAACCTCTCAAACGTTGCCTTTTTAAAAGCTTTCAAC
ATCGTTCGTGAGGTTTTCGGGGAGGGAGTATACCTCGGAGGAGGCGGATACCATCCTTAC
GCCCTCGCAAGGGCATGGACCCTAATCTGGTGCGAGCTTTCGGGAAGGGAAGTGCCGGAA
AAGCTAAACAATAAAGCAAAAGAGCTTTTAAAGAGTATAGACTTTGAAGAGTTTGACGAC
GAGGTGGACCGCTCGTACATGCTCGAAACCCTAAAGGACCCCTGGAGAGGAGGAGAGGTA
AGGAAAGAAGTAAAGGATACGCTTGAAAAGGCGAAAGCCTCATCTTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDO67135
UniProtKB Entry NameO67135_AQUAE
GenBank Gene IDAE000657
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02546Vorinostatapproved, investigationalunknownDetails
DB042977-[4-(Dimethylamino)Phenyl]-N-Hydroxy-4,6-Dimethyl-7-Oxo-2,4-HeptadienamideexperimentalunknownDetails