Solute carrier family 22 member 3

Details

Name
Solute carrier family 22 member 3
Synonyms
  • EMT
  • EMTH
  • Extraneuronal monoamine transporter
  • OCT3
  • Organic cation transporter 3
Gene Name
SLC22A3
Organism
Human
Amino acid sequence
>lcl|BSEQ0012537|Solute carrier family 22 member 3
MPSFDEALQRVGEFGRFQRRVFLLLCLTGVTFAFLFVGVVFLGTQPDHYWCRGPSAAALA
ERCGWSPEEEWNRTAPASRGPEPPERRGRCQRYLLEAANDSASATSALSCADPLAAFPNR
SAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLDLTQAILNLGFLTGAFTLGYAADRYG
RIVIYLLSCLGVGVTGVVVAFAPNFPVFVIFRFLQGVFGKGTWMTCYVIVTEIVGSKQRR
IVGIVIQMFFTLGIIILPGIAYFIPNWQGIQLAITLPSFLFLLYYWVVPESPRWLITRKK
GDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRKCTLILMFAWFT
SAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIERLGRRLPFAASNIVAGVA
CLVTAFLPEGIAWLRTTVATLGRLGITMAFEIVYLVNSELYPTTLRNFGVSLCSGLCDFG
GIIAPFLLFRLAAVWLELPLIIFGILASICGGLVMLLPETKGIALPETVDDVEKLGSPHS
CKCGRNKKTPVSRSHL
Number of residues
556
Molecular Weight
61279.485
Theoretical pI
8.64
GO Classification
Functions
dopamine transmembrane transporter activity / toxin transporter activity / organic cation transmembrane transporter activity / quaternary ammonium group transmembrane transporter activity
Processes
ammonium transmembrane transport / small molecule metabolic process / organic cation transport / transmembrane transport / regulation of appetite / histamine uptake / drug transmembrane transport / quaternary ammonium group transport / dopamine transport / mitophagy in response to mitochondrial depolarization
Components
membrane / plasma membrane / integral component of plasma membrane
General Function
Toxin transporter activity
Specific Function
Mediates potential-dependent transport of a variety of organic cations. May play a significant role in the disposition of cationic neurotoxins and neurotransmitters in the brain.
Pfam Domain Function
Transmembrane Regions
21-41 182-202 241-261 269-289 381-401 468-488 498-518
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0012538|Solute carrier family 22 member 3 (SLC22A3)
ATGCCCTCCTTCGACGAGGCGCTGCAGCGGGTGGGCGAGTTCGGGCGCTTCCAGAGGCGC
GTGTTTTTGCTGCTGTGCCTGACGGGCGTCACCTTCGCCTTCCTCTTCGTCGGCGTGGTC
TTCCTGGGCACGCAGCCCGACCACTACTGGTGCCGCGGGCCAAGTGCCGCGGCGCTGGCC
GAGCGCTGCGGCTGGAGCCCGGAGGAGGAGTGGAACCGCACGGCGCCCGCCTCCCGCGGC
CCAGAGCCCCCCGAGCGCCGCGGCCGCTGCCAGCGCTACCTCCTGGAGGCGGCCAACGAC
AGCGCCTCCGCCACTAGCGCTCTCAGCTGCGCGGACCCACTCGCCGCCTTCCCCAACCGC
TCGGCTCCCCTTGTGCCGTGCCGCGGCGGCTGGCGCTACGCCCAGGCCCACTCCACCATC
GTCAGCGAGTTTGACCTTGTCTGTGTCAATGCGTGGATGCTGGACCTCACCCAAGCCATC
CTGAACCTCGGCTTCCTGACTGGAGCATTCACCTTAGGCTATGCAGCAGACAGGTATGGC
AGGATCGTCATTTACTTGCTATCCTGCCTTGGTGTTGGCGTCACTGGGGTTGTGGTGGCC
TTTGCACCAAACTTCCCTGTGTTTGTGATCTTCCGCTTCCTGCAAGGTGTATTTGGAAAG
GGGACGTGGATGACTTGCTACGTGATTGTGACAGAAATAGTAGGTTCGAAACAAAGGAGG
ATTGTGGGAATCGTGATTCAAATGTTCTTTACCCTTGGAATCATAATTCTCCCTGGAATT
GCCTACTTCATCCCCAACTGGCAAGGAATCCAGTTAGCCATCACGCTGCCCAGCTTTCTC
TTCCTCCTTTATTACTGGGTGGTCCCTGAGTCTCCCCGTTGGCTGATTACTCGGAAGAAA
GGAGATAAAGCATTACAGATCCTGAGACGCATTGCTAAGTGCAATGGGAAATACCTCTCA
TCAAATTACTCAGAGATCACTGTTACAGATGAGGAAGTTAGTAATCCATCCTTTTTAGAT
CTGGTGAGAACTCCCCAAATGAGGAAATGCACACTTATTCTTATGTTTGCTTGGTTCACA
AGCGCAGTGGTGTATCAAGGACTTGTCATGCGCCTGGGAATTATAGGGGGCAACCTCTAT
ATAGACTTTTTCATCTCGGGCGTGGTGGAACTGCCAGGAGCTCTCTTGATCTTACTAACC
ATTGAGCGCCTTGGACGACGCCTCCCCTTTGCGGCAAGCAATATAGTGGCAGGGGTGGCA
TGCCTTGTCACTGCGTTCTTACCAGAAGGAATAGCATGGTTGAGGACCACAGTGGCTACA
TTGGGAAGACTAGGGATAACCATGGCCTTTGAAATTGTTTATTTGGTAAATTCAGAATTG
TACCCAACAACATTACGAAATTTCGGAGTTTCGCTCTGTTCAGGTCTGTGTGATTTTGGG
GGAATCATAGCCCCATTTCTGCTCTTTCGGCTAGCAGCCGTGTGGCTAGAACTACCTCTG
ATCATCTTTGGTATCCTGGCATCCATCTGTGGTGGCCTTGTGATGCTTTTGCCTGAAACC
AAGGGTATTGCCTTGCCAGAGACAGTGGATGATGTAGAAAAACTTGGCAGTCCACATTCC
TGTAAATGTGGCAGGAATAAGAAAACCCCAGTTTCCCGCTCTCACCTTTGA
Chromosome Location
6
Locus
6q26-q27
External Identifiers
ResourceLink
UniProtKB IDO75751
UniProtKB Entry NameS22A3_HUMAN
GenBank Protein ID3581982
GenBank Gene IDAJ001417
HGNC IDHGNC:10967
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01035ProcainamideapprovedunknowninhibitorDetails
DB00458ImipramineapprovedunknowninhibitorDetails
DB00536GuanidineapprovedunknownsubstrateinhibitorDetails
DB01151Desipramineapproved, investigationalunknowninhibitorDetails
DB00575ClonidineapprovedunknowninhibitorDetails
DB00396Progesteroneapproved, vet_approvedunknowninhibitorDetails
DB00457PrazosinapprovedunknowninhibitorDetails
DB00925PhenoxybenzamineapprovedunknowninhibitorDetails
DB00783Estradiolapproved, investigational, vet_approvedunknowninhibitorDetails
DB01394ColchicineapprovedunknowninhibitorDetails
DB00501Cimetidineapproved, investigationalunknownsubstrateinhibitorDetails
DB05381Histamineapproved, investigationalunknowninhibitorDetails
DB00988DopamineapprovedunknowninhibitorDetails
DB00122Cholineapproved, nutraceuticalunknowninhibitorDetails
DB00184NicotineapprovedunknowninhibitorDetails
DB00368NorepinephrineapprovedunknownsubstrateinhibitorDetails
DB01577Methamphetamineapproved, illicitunknowninhibitorDetails
DB00182Amphetamineapproved, illicit, investigationalunknowninhibitorDetails
DB00762Irinotecanapproved, investigationalunknowninhibitorDetails
DB01042MelphalanapprovedunknowninhibitorDetails
DB00541Vincristineapproved, investigationalunknowninhibitorDetails
DB00718Adefovir Dipivoxilapproved, investigationalunknownsubstrateDetails
DB00624Testosteroneapproved, investigationalunknownsubstrateDetails
DB00526Oxaliplatinapproved, investigationalunknownsubstrateDetails
DB08838Agmatineexperimental, investigationalunknownsubstrateDetails
DB08837Tetraethylammoniumexperimental, investigationalunknownDetails
DB08841Tyramineinvestigational, nutraceuticalunknownDetails
DB00709Lamivudineapproved, investigationalunknownsubstrateDetails
DB00331MetforminapprovedunknownsubstrateDetails
DB13943Testosterone cypionateapprovedunknownsubstrateDetails
DB13944Testosterone enanthateapprovedunknownsubstrateDetails
DB13946Testosterone undecanoateapproved, investigationalunknownsubstrateDetails
DB13952Estradiol acetateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13953Estradiol benzoateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13954Estradiol cypionateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13955Estradiol dienanthateapproved, investigational, vet_approvedunknowninhibitorDetails
DB13956Estradiol valerateapproved, investigational, vet_approvedunknowninhibitorDetails
DB14006Choline salicylateapproved, nutraceuticalunknowninhibitorDetails