Solute carrier family 22 member 5

Details

Name
Solute carrier family 22 member 5
Synonyms
  • High-affinity sodium-dependent carnitine cotransporter
  • OCTN2
  • Organic cation/carnitine transporter 2
Gene Name
SLC22A5
Organism
Human
Amino acid sequence
>lcl|BSEQ0000212|Solute carrier family 22 member 5
MRDYDEVTAFLGEWGPFQRLIFFLLSASIIPNGFTGLSSVFLIATPEHRCRVPDAANLSS
AWRNHTVPLRLRDGREVPHSCRRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFS
QDVYLSTIVTEWNLVCEDDWKAPLTISLFFVGVLLGSFISGQLSDRFGRKNVLFVTMGMQ
TGFSFLQIFSKNFEMFVVLFVLVGMGQISNYVAAFVLGTEILGKSVRIIFSTLGVCIFYA
FGYMVLPLFAYFIRDWRMLLVALTMPGVLCVALWWFIPESPRWLISQGRFEEAEVIIRKA
AKANGIVVPSTIFDPSELQDLSSKKQQSHNILDLLRTWNIRMVTIMSIMLWMTISVGYFG
LSLDTPNLHGDIFVNCFLSAMVEVPAYVLAWLLLQYLPRRYSMATALFLGGSVLLFMQLV
PPDLYYLATVLVMVGKFGVTAAFSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYF
VYLGAYDRFLPYILMGSLTILTAILTLFLPESFGTPLPDTIDQMLRVKGMKHRKTPSHTR
MLKDGQERPTILKSTAF
Number of residues
557
Molecular Weight
62751.08
Theoretical pI
8.04
GO Classification
Functions
ATP binding / drug transmembrane transporter activity / PDZ domain binding / quaternary ammonium group transmembrane transporter activity / symporter activity / carnitine transmembrane transporter activity / cation
Processes
quaternary ammonium group transport / quorum sensing involved in interaction with host / sodium ion transport / sodium-dependent organic cation transport / drug transport / carnitine metabolic process / carnitine transmembrane transport / transmembrane transport / carnitine transport / drug transmembrane transport / modified amino acid transport / positive regulation of intestinal epithelial structure maintenance
Components
plasma membrane / extracellular exosome / integral component of plasma membrane / apical plasma membrane / brush border membrane
General Function
Symporter activity
Specific Function
Sodium-ion dependent, high affinity carnitine transporter. Involved in the active cellular uptake of carnitine. Transports one sodium ion with one molecule of carnitine. Also transports organic cations such as tetraethylammonium (TEA) without the involvement of sodium. Also relative uptake activity ratio of carnitine to TEA is 11.3.
Pfam Domain Function
Transmembrane Regions
21-41 143-163 173-193 198-218 233-253 258-278 342-362 374-394 407-427 431-451 463-483 489-509
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0009938|Solute carrier family 22 member 5 (SLC22A5)
ATGCGGGACTACGACGAGGTGACCGCCTTCCTGGGCGAGTGGGGGCCCTTCCAGCGCCTC
ATCTTCTTCCTGCTCAGCGCCAGCATCATCCCCAATGGCTTCACCGGCCTGTCCTCCGTG
TTCCTGATAGCGACCCCGGAGCACCGCTGCCGGGTGCCGGACGCCGCGAACCTGAGCAGC
GCCTGGCGCAACCACACTGTCCCACTGCGGCTGCGGGACGGCCGCGAGGTGCCCCACAGC
TGCCGCCGCTACCGGCTCGCCACCATCGCCAACTTCTCGGCGCTTGGGCTGGAGCCGGGG
CGCGACGTGGACCTGGGGCAGCTGGAGCAGGAGAGCTGTCTGGATGGCTGGGAGTTCAGT
CAGGACGTCTACCTGTCCACCATTGTGACCGAGCAAGACAGTGGGGCCTACAATGCTATG
AAAAACAGGATGGGAAAGAAGCCTGCTCTCTGCCTTCCTGCCCAGTGGAACCTGGTGTGT
GAGGACGACTGGAAGGCCCCACTCACAATCTCCTTGTTCTTCGTGGGTGTGCTGTTGGGC
TCCTTCATTTCAGGGCAGCTGTCAGACAGGTTTGGCCGGAAGAATGTGCTGTTCGTGACC
ATGGGCATGCAGACAGGCTTCAGCTTCCTGCAGATCTTCTCGAAGAATTTTGAGATGTTT
GTCGTGCTGTTTGTCCTTGTAGGCATGGGCCAGATCTCCAACTATGTGGCAGCATTTGTC
CTGGGGACAGAAATTCTTGGCAAGTCAGTTCGTATAATATTCTCTACGTTAGGAGTGTGC
ATATTTTATGCATTTGGCTACATGGTGCTGCCACTGTTTGCTTACTTCATCCGAGACTGG
CGGATGCTGCTGGTGGCGCTGACGATGCCGGGGGTGCTATGCGTGGCACTCTGGTGGTTC
ATCCCTGAGTCCCCCCGATGGCTCATCTCTCAGGGACGATTTGAAGAGGCAGAGGTGATC
ATCCGCAAGGCTGCCAAAGCCAATGGGATTGTTGTGCCTTCCACTATCTTTGACCCGAGT
GAGTTACAAGACCTAAGTTCCAAGAAGCAGCAGTCCCACAACATTCTGGATCTGCTTCGA
ACCTGGAATATCCGGATGGTCACCATCATGTCCATAATGCTGTGGATGACCATATCAGTG
GGCTATTTTGGGCTTTCGCTTGATACTCCTAACTTGCATGGGGACATCTTTGTGAACTGC
TTCCTTTCAGCGATGGTTGAAGTCCCAGCATATGTGTTGGCCTGGCTGCTGCTGCAATAT
TTGCCCCGGCGCTATTCCATGGCCACTGCCCTCTTCCTGGGTGGCAGTGTCCTTCTCTTC
ATGCAGCTGGTACCCCCAGACTTGTATTATTTGGCTACAGTCCTGGTGATGGTGGGCAAG
TTTGGAGTCACGGCTGCCTTTTCCATGGTCTACGTGTACACAGCCGAGCTGTATCCCACA
GTGGTGAGAAACATGGGTGTGGGAGTCAGCTCCACAGCATCCCGCCTGGGCAGCATCCTG
TCTCCCTACTTCGTTTACCTTGGTGCCTACGACCGCTTCCTGCCCTACATTCTCATGGGA
AGTCTGACCATCCTGACAGCCATCCTCACCTTGTTTCTCCCAGAGAGCTTCGGTACCCCA
CTCCCAGACACCATTGACCAGATGCTAAGAGTCAAAGGAATGAAACACAGAAAAACTCCA
AGTCACACAAGGATGTTAAAAGATGGTCAAGAAAGGCCCACAATCCTTAAAAGCACAGCC
TTCTAA
Chromosome Location
5
Locus
5q31
External Identifiers
ResourceLink
UniProtKB IDO76082
UniProtKB Entry NameS22A5_HUMAN
GenBank Protein ID3273741
GenBank Gene IDAF057164
GenAtlas IDSLC22A5
HGNC IDHGNC:10969
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00583L-Carnitineapproved, investigationalunknownDetails
DB01035ProcainamideapprovedunknowninhibitorDetails
DB00184NicotineapprovedunknowninhibitorDetails
DB01577Methamphetamineapproved, illicitunknowninhibitorDetails
DB00536GuanidineapprovedunknowninhibitorDetails
DB00501Cimetidineapproved, investigationalunknowninhibitorDetails
DB00122Cholineapproved, nutraceuticalunknowninhibitorDetails
DB00182Amphetamineapproved, illicit, investigationalunknowninhibitorDetails
DB01151Desipramineapproved, investigationalunknowninhibitorDetails
DB00661VerapamilapprovedunknowninhibitorDetails
DB00313Valproic Acidapproved, investigationalunknowninhibitorDetails
DB01208Sparfloxacinapproved, investigationalunknowninhibitorDetails
DB00468QuinineapprovedunknowninhibitorDetails
DB00908Quinidineapproved, investigationalunknowninhibitorDetails
DB01032Probenecidapproved, investigationalunknowninhibitorDetails
DB00345Aminohippuric acidapproved, investigationalunknowninhibitorDetails
DB01165OfloxacinapprovedunknowninhibitorDetails
DB01059NorfloxacinapprovedunknowninhibitorDetails
DB00627Niacinapproved, investigational, nutraceuticalunknowninhibitorDetails
DB00978Lomefloxacinapproved, investigationalunknowninhibitorDetails
DB00365Grepafloxacinapproved, investigational, withdrawnunknowninhibitorDetails
DB00695Furosemideapproved, vet_approvedunknowninhibitorDetails
DB00148Creatineapproved, investigational, nutraceuticalunknowninhibitorDetails
DB00575ClonidineapprovedunknowninhibitorDetails
DB00456Cefalotinapproved, investigational, vet_approvedunknowninhibitorDetails
DB00689CephaloglycinapprovedunknowninhibitorDetails
DB00125L-Arginineapproved, nutraceuticalunknowninhibitorDetails
DB04630Aldosteroneexperimental, investigationalunknowninhibitorDetails
DB00970Dactinomycinapproved, investigationalunknowninhibitorDetails
DB01053Benzylpenicillinapproved, vet_approvedunknowninhibitorDetails
DB01000CyclacillinapprovedunknowninhibitorDetails
DB01333CefradineapprovedunknowninhibitorDetails
DB00567Cephalexinapproved, investigational, vet_approvedunknowninhibitorDetails
DB00438CeftazidimeapprovedunknowninhibitorDetails
DB00671Cefiximeapproved, investigationalunknowninhibitorDetails
DB01413Cefepimeapproved, investigationalunknowninhibitorDetails
DB00535CefdinirapprovedunknowninhibitorDetails
DB01140Cefadroxilapproved, vet_approved, withdrawnunknowninhibitorDetails
DB00415Ampicillinapproved, vet_approvedunknowninhibitorDetails
DB00152Thiamineapproved, investigational, nutraceutical, vet_approvedunknowninhibitorDetails
DB00368NorepinephrineapprovedunknowninhibitorDetails
DB00281Lidocaineapproved, vet_approvedunknowninhibitorDetails
DB05381Histamineapproved, investigationalunknowninhibitorDetails
DB00668Epinephrineapproved, vet_approvedunknowninhibitorDetails
DB00988DopamineapprovedunknowninhibitorDetails
DB01075Diphenhydramineapproved, investigationalunknowninhibitorDetails
DB03128AcetylcholineapprovedunknowninhibitorDetails
DB00583L-Carnitineapproved, investigationalunknownsubstrateDetails
DB00332Ipratropium bromideapprovedunknownsubstrateDetails
DB01409TiotropiumapprovedunknownsubstrateDetails
DB08795AzidocillinapprovedunknowninhibitorDetails
DB08837Tetraethylammoniumexperimental, investigationalunknownDetails
DB06691Mepyramineapproved, vet_approvedunknownDetails
DB08842Acetylcarnitineapproved, investigationalunknownDetails
DB04133Degraded CephaloridineexperimentalunknownDetails
DB14006Choline salicylateapproved, nutraceuticalunknowninhibitorDetails