NADH dehydrogenase [ubiquinone] 1 subunit C2

Details

Name
NADH dehydrogenase [ubiquinone] 1 subunit C2
Synonyms
  • CI-B14.5b
  • Complex I-B14.5b
  • HLC-1
  • Human lung cancer oncogene 1 protein
  • NADH-ubiquinone oxidoreductase subunit B14.5b
Gene Name
NDUFC2
Organism
Human
Amino acid sequence
>lcl|BSEQ0000345|NADH dehydrogenase [ubiquinone] 1 subunit C2
MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQ
LLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR
Number of residues
119
Molecular Weight
14187.33
Theoretical pI
9.27
GO Classification
Functions
NADH dehydrogenase (ubiquinone) activity
Processes
mitochondrial electron transport, NADH to ubiquinone / small molecule metabolic process / cellular metabolic process / respiratory electron transport chain
Components
cytoplasm / mitochondrial inner membrane / integral component of membrane / mitochondrial respiratory chain complex I
General Function
Nadh dehydrogenase (ubiquinone) activity
Specific Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Pfam Domain Function
Transmembrane Regions
56-75
Cellular Location
Mitochondrion inner membrane
Gene sequence
>lcl|BSEQ0010190|NADH dehydrogenase [ubiquinone] 1 subunit C2 (NDUFC2)
ATGATCGCACGGCGGAACCCAGAACCCTTACGGTTTCTGCCGGATGAGGCCCGGAGCCTG
CCCCCGCCCAAGCTGACCGACCCGCGGCTCCTCTACATCGGCTTCTTGGGCTACTGCTCC
GGCCTGATTGATAACCTAATCCGGCGGAGGCCGATCGCGACGGCTGGTTTGCATCGCCAG
CTTCTATATATTACGGCCTTTTTTTTTGCTGGATATTATCTTGTAAAACTTGAAGCTTAT
GCTAATCTGTATGTTGACACCTTGTAA
Chromosome Location
11
Locus
11q14.1
External Identifiers
ResourceLink
UniProtKB IDO95298
UniProtKB Entry NameNDUC2_HUMAN
GenBank Protein ID4191346
GenBank Gene IDAF087659
GenAtlas IDNDUFC2
HGNC IDHGNC:7706
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00157NADHapproved, nutraceuticalunknownDetails
DB01136Carvedilolapproved, investigationalunknowninhibitorDetails