Cytochrome c3, 13 kDa
Details
- Name
- Cytochrome c3, 13 kDa
- Synonyms
- Not Available
- Gene Name
- Not Available
- Organism
- Desulfovibrio baculatus (strain Norway 4)
- Amino acid sequence
>lcl|BSEQ0012139|Cytochrome c3, 13 kDa ADAPGDDYVISAPEGMKAKPKGDKPGALQKTVPFPHTKHATVECVQCHHTLEADGGAVKK CTTSGCHDSLEFRDKANAKDIKLVENAFHTQCIDCHKALKKDKKPTGPTACGKCHTTN
- Number of residues
- 118
- Molecular Weight
- 12622.275
- Theoretical pI
- 8.23
- GO Classification
- Functionselectron carrier activity / heme binding / metal ion bindingProcessesanaerobic respirationComponentsperiplasmic space
- General Function
- Metal ion binding
- Specific Function
- Participates in sulfate respiration coupled with phosphorylation by transferring electrons from the enzyme dehydrogenase to ferredoxin.
- Pfam Domain Function
- Cytochrom_CIII (PF02085)
- Transmembrane Regions
- Not Available
- Cellular Location
- Periplasm
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P00136 UniProtKB Entry Name CYC31_DESNO - General References
- Bruschi M, Leroy G, Guerlesquin F, Bonicel J: Amino-acid sequence of the cytochrome c3 (M(r) 26,000) from Desulfovibrio desulfuricans Norway and a comparison with those of the other polyhemic cytochromes from Desulfovibrio. Biochim Biophys Acta. 1994 Mar 16;1205(1):123-31. [Article]
- Loutfi M, Guerlesquin F, Bianco P, Haladjian J, Bruschi M: Comparative studies of polyhemic cytochromes c isolated from Desulfovibrio vulgaris (Hildenborough) and Desulfovibrio desulfuricans (Norway). Biochem Biophys Res Commun. 1989 Mar 15;159(2):670-6. [Article]
- Haser R, Pierrot M, Frey M, Payan F, Astier JP, Bruschi M, Le Gall J: Structure and sequence of the multihaem cytochrome c3. Nature. 1979 Dec 20-27;282(5741):806-10. [Article]
- Pierrot M, Haser R, Frey M, Payan F, Astier JP: Crystal structure and electron transfer properties of cytochrome c3. J Biol Chem. 1982 Dec 10;257(23):14341-8. [Article]
- Czjzek M, Payan F, Guerlesquin F, Bruschi M, Haser R: Crystal structure of cytochrome c3 from Desulfovibrio desulfuricans Norway at 1.7 A resolution. J Mol Biol. 1994 Nov 4;243(4):653-67. [Article]