Carbonic anhydrase 1

Details

Name
Carbonic anhydrase 1
Synonyms
  • 4.2.1.1
  • CA-I
  • CAB
  • Carbonate dehydratase I
  • Carbonic anhydrase B
  • Carbonic anhydrase I
Gene Name
CA1
Organism
Human
Amino acid sequence
>lcl|BSEQ0010047|Carbonic anhydrase 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
Number of residues
261
Molecular Weight
28870.0
Theoretical pI
7.14
GO Classification
Functions
zinc ion binding / hydro-lyase activity / carbonate dehydratase activity / arylesterase activity
Processes
small molecule metabolic process / bicarbonate transport / one-carbon metabolic process
Components
cytosol / extracellular exosome
General Function
Zinc ion binding
Specific Function
Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0010048|Carbonic anhydrase 1 (CA1)
ATGGCAAGTCCAGACTGGGGATATGATGACAAAAATGGTCCTGAACAATGGAGCAAGCTG
TATCCCATTGCCAATGGAAATAACCAGTCCCCTGTTGATATTAAAACCAGTGAAACCAAA
CATGACACCTCTCTGAAACCTATTAGTGTCTCCTACAACCCAGCCACAGCCAAAGAAATT
ATCAATGTGGGGCATTCCTTCCATGTAAATTTTGAGGACAACGATAACCGATCAGTGCTG
AAAGGTGGTCCTTTCTCTGACAGCTACAGGCTCTTTCAGTTCCATTTTCACTGGGGCAGT
ACAAATGAGCATGGTTCAGAACATACAGTGGATGGAGTCAAATATTCTGCCGAGCTTCAC
GTAGCTCACTGGAATTCTGCAAAGTACTCCAGCCTTGCTGAAGCTGCCTCAAAGGCTGAT
GGTTTGGCAGTTATTGGTGTTTTGATGAAGGTTGGTGAGGCCAACCCAAAGCTGCAGAAA
GTACTTGATGCCCTCCAAGCAATTAAAACCAAGGGCAAACGAGCCCCATTCACAAATTTT
GACCCCTCTACTCTCCTTCCTTCATCCCTGGATTTCTGGACCTACCCTGGCTCTCTGACT
CATCCTCCTCTTTATGAGAGTGTAACTTGGATCATCTGTAAGGAGAGCATCAGTGTCAGC
TCAGAGCAGCTGGCACAATTCCGCAGCCTTCTATCAAATGTTGAAGGTGATAACGCTGTC
CCCATGCAGCACAACAACCGCCCAACCCAACCTCTGAAGGGCAGAACAGTGAGAGCTTCA
TTTTGA
Chromosome Location
8
Locus
8q13-q22.1
External Identifiers
ResourceLink
UniProtKB IDP00915
UniProtKB Entry NameCAH1_HUMAN
GenBank Protein ID29600
GenBank Gene IDX05014
GenAtlas IDCA1
HGNC IDHGNC:1368
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00311EthoxzolamidewithdrawnyesinhibitorDetails
DB00381AmlodipineapprovedunknowninhibitorDetails
DB00703MethazolamideapprovedyesinhibitorDetails
DB00819Acetazolamideapproved, vet_approvedyesinhibitorDetails
DB01144Diclofenamideapproved, investigationalyesinhibitorDetails
DB01194BrinzolamideapprovedunknowninhibitorDetails
DB00232MethyclothiazideapprovedunknowninhibitorDetails
DB00436BendroflumethiazideapprovedunknowninhibitorDetails
DB00562BenzthiazideapprovedunknowninhibitorDetails
DB00606CyclothiazideapprovedunknowninhibitorDetails
DB00774Hydroflumethiazideapproved, investigationalunknowninhibitorDetails
DB00880Chlorothiazideapproved, vet_approvedyesinhibitorDetails
DB00909Zonisamideapproved, investigationalunknowninhibitorDetails
DB00999Hydrochlorothiazideapproved, vet_approvedunknowninhibitorDetails
DB01021Trichlormethiazideapproved, vet_approvedunknowninhibitorDetails
DB01031Ethinamateapproved, illicit, withdrawnyesinhibitorDetails
DB01119DiazoxideapprovedyesinhibitorDetails
DB01325QuinethazoneapprovedyesinhibitorDetails
DB00869DorzolamideapprovedunknowninhibitorDetails
DB08155N-{2-[4-(AMINOSULFONYL)PHENYL]ETHYL}ACETAMIDEexperimentalunknownDetails
DB081563-[4-(AMINOSULFONYL)PHENYL]PROPANOIC ACIDexperimentalunknownDetails
DB08157ETHYL 3-[4-(AMINOSULFONYL)PHENYL]PROPANOATEexperimentalunknownDetails
DB00423Methocarbamolapproved, vet_approvednoinhibitorDetails
DB08846Ellagic AcidinvestigationalunknowninhibitorDetails
DB09460Sodium carbonateapprovedunknowninhibitorDetails
DB09472Sodium sulfateapproved, vet_approvedyesinhibitorDetails
DB00273TopiramateapprovedunknowninhibitorDetails
DB01593Zincapproved, investigationalunknownsubstrateDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails