Interferon beta

Details

Name
Interferon beta
Synonyms
  • Fibroblast interferon
  • IFB
  • IFN-beta
  • IFNB
Gene Name
IFNB1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0010650|Interferon beta
MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFD
IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK
TVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR
LTGYLRN
Number of residues
187
Molecular Weight
22293.68
Theoretical pI
8.91
GO Classification
Functions
chloramphenicol O-acetyltransferase activity / cytokine activity / type I interferon receptor binding
Processes
adaptive immune response / B cell activation involved in immune response / B cell differentiation / B cell proliferation / blood coagulation / cell surface receptor signaling pathway / cellular response to dexamethasone stimulus / cellular response to exogenous dsRNA / cellular response to interferon-beta / cellular response to virus / cytokine-mediated signaling pathway / defense response to bacterium / defense response to virus / humoral immune response / innate immune response / natural killer cell activation / natural killer cell activation involved in immune response / negative regulation of T cell differentiation / negative regulation of T-helper 2 cell cytokine production / negative regulation of viral genome replication / positive regulation of apoptotic signaling pathway / positive regulation of innate immune response / positive regulation of peptidyl-serine phosphorylation of STAT protein / positive regulation of transcription from RNA polymerase II promoter / regulation of MHC class I biosynthetic process / regulation of type I interferon-mediated signaling pathway / response to exogenous dsRNA / response to virus / T cell activation involved in immune response / type I interferon signaling pathway
Components
extracellular region / extracellular space
General Function
Type i interferon receptor binding
Specific Function
Has antiviral, antibacterial and anticancer activities.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0010651|Interferon beta (IFNB1)
ATGACCAACAAGTGTCTCCTCCAAATTGCTCTCCTGTTGTGCTTCTCCACTACAGCTCTT
TCCATGAGCTACAACTTGCTTGGATTCCTACAAAGAAGCAGCAATTTTCAGTGTCAGAAG
CTCCTGTGGCAATTGAATGGGAGGCTTGAATACTGCCTCAAGGACAGGATGAACTTTGAC
ATCCCTGAGGAGATTAAGCAGCTGCAGCAGTTCCAGAAGGAGGACGCCGCATTGACCATC
TATGAGATGCTCCAGAACATCTTTGCTATTTTCAGACAAGATTCATCTAGCACTGGCTGG
AATGAGACTATTGTTGAGAACCTCCTGGCTAATGTCTATCATCAGATAAACCATCTGAAG
ACAGTCCTGGAAGAAAAACTGGAGAAAGAAGATTTCACCAGGGGAAAACTCATGAGCAGT
CTGCACCTGAAAAGATATTATGGGAGGATTCTGCATTACCTGAAGGCCAAGGAGTACAGT
CACTGTGCCTGGACCATAGTCAGAGTGGAAATCCTAAGGAACTTTTACTTCATTAACAGA
CTTACAGGTTACCTCCGAAACTGA
Chromosome Location
9
Locus
9p21
External Identifiers
ResourceLink
UniProtKB IDP01574
UniProtKB Entry NameIFNB_HUMAN
GenBank Protein ID32638
GenBank Gene IDV00534
GenAtlas IDIFNB1
HGNC IDHGNC:5434
General References
  1. Lawn RM, Adelman J, Franke AE, Houck CM, Gross M, Najarian R, Goeddel DV: Human fibroblast interferon gene lacks introns. Nucleic Acids Res. 1981 Mar 11;9(5):1045-52. [Article]
  2. Ohno S, Taniguchi T: Structure of a chromosomal gene for human interferon beta. Proc Natl Acad Sci U S A. 1981 Sep;78(9):5305-9. [Article]
  3. Taniguchi T, Ohno S, Fujii-Kuriyama Y, Muramatsu M: The nucleotide sequence of human fibroblast interferon cDNA. Gene. 1980 Jun;10(1):11-5. [Article]
  4. Derynck R, Content J, DeClercq E, Volckaert G, Tavernier J, Devos R, Fiers W: Isolation and structure of a human fibroblast interferon gene. Nature. 1980 Jun 19;285(5766):542-7. [Article]
  5. Houghton M, Easton MA, Stewart AG, Smith JC, Doel SM, Catlin GH, Lewis HM, Patel TP, Emtage JS, Carey NH, Porter AG: The complete amino acid sequence of human fibroblast interferon as deduced using synthetic oligodeoxyribonucleotide primers of reverse transcriptase. Nucleic Acids Res. 1980 Jul 11;8(13):2885-94. [Article]
  6. Goeddel DV, Shepard HM, Yelverton E, Leung D, Crea R, Sloma A, Pestka S: Synthesis of human fibroblast interferon by E. coli. Nucleic Acids Res. 1980 Sep 25;8(18):4057-74. [Article]
  7. May LT, Sehgal PB: On the relationship between human interferon alpha 1 and beta 1 genes. J Interferon Res. 1985 Summer;5(3):521-6. [Article]
  8. Goshima N, Kawamura Y, Fukumoto A, Miura A, Honma R, Satoh R, Wakamatsu A, Yamamoto J, Kimura K, Nishikawa T, Andoh T, Iida Y, Ishikawa K, Ito E, Kagawa N, Kaminaga C, Kanehori K, Kawakami B, Kenmochi K, Kimura R, Kobayashi M, Kuroita T, Kuwayama H, Maruyama Y, Matsuo K, Minami K, Mitsubori M, Mori M, Morishita R, Murase A, Nishikawa A, Nishikawa S, Okamoto T, Sakagami N, Sakamoto Y, Sasaki Y, Seki T, Sono S, Sugiyama A, Sumiya T, Takayama T, Takayama Y, Takeda H, Togashi T, Yahata K, Yamada H, Yanagisawa Y, Endo Y, Imamoto F, Kisu Y, Tanaka S, Isogai T, Imai J, Watanabe S, Nomura N: Human protein factory for converting the transcriptome into an in vitro-expressed proteome,. Nat Methods. 2008 Dec;5(12):1011-7. [Article]
  9. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  10. Houghton M, Stewart AG, Doel SM, Emtage JS, Eaton MA, Smith JC, Patel TP, Lewis HM, Porter AG, Birch JR, Cartwright T, Carey NH: The amino-terminal sequence of human fibroblast interferon as deduced from reverse transcripts obtained using synthetic oligonucleotide primers. Nucleic Acids Res. 1980 May 10;8(9):1913-31. [Article]
  11. Wetzel R: Assignment of the disulphide bonds of leukocyte interferon. Nature. 1981 Feb 12;289(5798):606-7. [Article]
  12. Shepard HM, Leung D, Stebbing N, Goeddel DV: A single amino acid change in IFN-beta1 abolishes its antiviral activity. Nature. 1981 Dec 10;294(5841):563-5. [Article]
  13. Karpusas M, Nolte M, Benton CB, Meier W, Lipscomb WN, Goelz S: The crystal structure of human interferon beta at 2.2-A resolution. Proc Natl Acad Sci U S A. 1997 Oct 28;94(22):11813-8. [Article]
  14. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02379Beta-D-GlucoseexperimentalunknownDetails