Ig heavy chain V-III region 23

Details

Name
Ig heavy chain V-III region 23
Synonyms
  • Ig heavy chain V-III region VH26
  • Immunoglobulin heavy variable 3-23
Gene Name
IGHV3-23
Organism
Humans
Amino acid sequence
>lcl|BSEQ0020749|Ig heavy chain V-III region 23
MEFGLSWLFLVAILKGVQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAP
GKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK
Number of residues
117
Molecular Weight
12582.21
Theoretical pI
8.46
GO Classification
Functions
antigen binding / immunoglobulin receptor binding
Processes
B cell receptor signaling pathway / complement activation / complement activation, classical pathway / defense response to bacterium / Fc-epsilon receptor signaling pathway / Fc-gamma receptor signaling pathway involved in phagocytosis / immune response / innate immune response / phagocytosis, engulfment / phagocytosis, recognition / positive regulation of B cell activation / receptor-mediated endocytosis / regulation of immune response
Components
blood microparticle / external side of plasma membrane / extracellular exosome / extracellular region / immunoglobulin complex, circulating / plasma membrane
General Function
Immunoglobulin receptor binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP01764
UniProtKB Entry NameHV303_HUMAN
GenBank Protein ID553422
GenBank Gene IDM35415
HGNC IDHGNC:5588
General References
  1. Matthyssens G, Rabbitts TH: Structure and multiplicity of genes for the human immunoglobulin heavy chain variable region. Proc Natl Acad Sci U S A. 1980 Nov;77(11):6561-5. [Article]
  2. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [Article]
  3. Mariette X, Tsapis A, Brouet JC: Nucleotidic sequence analysis of the variable domains of four human monoclonal IgM with an antibody activity to myelin-associated glycoprotein. Eur J Immunol. 1993 Apr;23(4):846-51. [Article]
  4. Toyonaga B, Yoshikai Y, Vadasz V, Chin B, Mak TW: Organization and sequences of the diversity, joining, and constant region genes of the human T-cell receptor beta chain. Proc Natl Acad Sci U S A. 1985 Dec;82(24):8624-8. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04147Dodecyldimethylamine N-oxideexperimentalunknownDetails