T-cell receptor beta-1 chain C region
Details
- Name
- T-cell receptor beta-1 chain C region
- Synonyms
- Not Available
- Gene Name
- TRBC1
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0037260|T-cell receptor beta-1 chain C region EDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDP QPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQI VSAEAWGRADCGFTSVSYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDF
- Number of residues
- 177
- Molecular Weight
- 19898.43
- Theoretical pI
- 5.23
- GO Classification
- Processesimmune response / regulation of immune response / T cell costimulation / T cell receptor signaling pathwayComponentsintegral component of membrane / membrane / plasma membrane
- General Function
- Not Available
- Specific Function
- Not Available
- Pfam Domain Function
- C1-set (PF07654)
- Transmembrane Regions
- 151-171
- Cellular Location
- Membrane
- Chromosome Location
- Not Available
- Locus
- 7q34
- External Identifiers
Resource Link UniProtKB ID P01850 UniProtKB Entry Name TRBC1_HUMAN GenBank Protein ID 338835 GenBank Gene ID M12887 HGNC ID HGNC:12156 - General References
- Yanagi Y, Yoshikai Y, Leggett K, Clark SP, Aleksander I, Mak TW: A human T cell-specific cDNA clone encodes a protein having extensive homology to immunoglobulin chains. Nature. 1984 Mar 8-14;308(5955):145-9. [Article]
- Tunnacliffe A, Kefford R, Milstein C, Forster A, Rabbitts TH: Sequence and evolution of the human T-cell antigen receptor beta-chain genes. Proc Natl Acad Sci U S A. 1985 Aug;82(15):5068-72. [Article]
- Rowen L, Koop BF, Hood L: The complete 685-kilobase DNA sequence of the human beta T cell receptor locus. Science. 1996 Jun 21;272(5269):1755-62. [Article]
- Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [Article]
- Stewart-Jones GB, McMichael AJ, Bell JI, Stuart DI, Jones EY: A structural basis for immunodominant human T cell receptor recognition. Nat Immunol. 2003 Jul;4(7):657-63. Epub 2003 Jun 8. [Article]
- Gras S, Burrows SR, Kjer-Nielsen L, Clements CS, Liu YC, Sullivan LC, Bell MJ, Brooks AG, Purcell AW, McCluskey J, Rossjohn J: The shaping of T cell receptor recognition by self-tolerance. Immunity. 2009 Feb 20;30(2):193-203. doi: 10.1016/j.immuni.2008.11.011. Epub 2009 Jan 22. [Article]