Complement C1q subcomponent subunit B

Details

Name
Complement C1q subcomponent subunit B
Synonyms
  • Complement C1q subcomponent subunit B precursor
Gene Name
C1QB
Organism
Human
Amino acid sequence
>lcl|BSEQ0016676|Complement C1q subcomponent subunit B
MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKG
EKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQ
KIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNL
CVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANS
IFSGFLLFPDMEA
Number of residues
253
Molecular Weight
26721.62
Theoretical pI
8.87
GO Classification
Processes
complement activation / innate immune response / inner ear development / complement activation, classical pathway
Components
extracellular region / extracellular exosome / blood microparticle / collagen trimer / complement component C1 complex
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0016677|Complement C1q subcomponent subunit B (C1QB)
ATGATGATGAAGATCCCATGGGGCAGCATCCCAGTACTGATGTTGCTCCTGCTCCTGGGC
CTAATCGATATCTCCCAGGCCCAGCTCAGCTGCACCGGGCCCCCAGCCATCCCTGGCATC
CCGGGTATCCCTGGGACACCTGGCCCCGATGGCCAACCTGGGACCCCAGGGATAAAAGGA
GAGAAAGGGCTTCCAGGGCTGGCTGGAGACCATGGTGAGTTCGGAGAGAAGGGAGACCCA
GGGATTCCTGGGAATCCAGGAAAAGTCGGCCCCAAGGGCCCCATGGGCCCTAAAGGTGGC
CCAGGGGCCCCTGGAGCCCCAGGCCCCAAAGGTGAATCGGGAGACTACAAGGCCACCCAG
AAAATCGCCTTCTCTGCCACAAGAACCATCAACGTCCCCCTGCGCCGGGACCAGACCATC
CGCTTCGACCACGTGATCACCAACATGAACAACAATTATGAGCCCCGCAGTGGCAAGTTC
ACCTGCAAGGTGCCCGGTCTCTACTACTTCACCTACCACGCCAGCTCTCGAGGGAACCTG
TGCGTGAACCTCATGCGTGGCCGGGAGCGTGCACAGAAGGTGGTCACCTTCTGTGACTAT
GCCTACAACACCTTCCAGGTCACCACCGGTGGCATGGTCCTCAAGCTGGAGCAGGGGGAG
AACGTCTTCCTGCAGGCCACCGACAAGAACTCACTACTGGGCATGGAGGGTGCCAACAGC
ATCTTTTCCGGGTTCCTGCTCTTTCCAGATATGGAGGCCTGA
Chromosome Location
1
Locus
1p36.12
External Identifiers
ResourceLink
UniProtKB IDP02746
UniProtKB Entry NameC1QB_HUMAN
GenBank Protein ID573114
GenBank Gene IDX03084
GenAtlas IDC1QB
HGNC IDHGNC:1242
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00002CetuximabapprovedunknownDetails
DB00005Etanerceptapproved, investigationalunknownDetails
DB00054AbciximabapprovedunknownDetails
DB00056Gemtuzumab ozogamicinapproved, investigationalunknownDetails
DB00072Trastuzumabapproved, investigationalunknownDetails
DB00074Basiliximabapproved, investigationalunknownDetails
DB00075Muromonabapproved, investigationalunknownDetails
DB00078Ibritumomab tiuxetanapproved, investigationalunknownDetails
DB00081Tositumomabapproved, investigationalunknownDetails
DB00087Alemtuzumabapproved, investigationalunknownDetails
DB00092Alefaceptapproved, investigational, withdrawnunknownDetails
DB00095Efalizumabapproved, investigationalunknownDetails
DB00108Natalizumabapproved, investigationalunknownDetails
DB00110Palivizumabapproved, investigationalunknownDetails
DB00111Daclizumabinvestigational, withdrawnunknownDetails
DB00112Bevacizumabapproved, investigationalunknownDetails
DB01593Zincapproved, investigationalunknownDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails