Alpha-1-acid glycoprotein 1

Details

Name
Alpha-1-acid glycoprotein 1
Synonyms
  • AGP 1
  • AGP1
  • OMD 1
  • Orosomucoid-1
Gene Name
ORM1
Organism
Human
Amino acid sequence
>lcl|BSEQ0001842|Alpha-1-acid glycoprotein 1
MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQ
EIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLL
ILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKK
DKCEPLEKQHEKERKQEEGES
Number of residues
201
Molecular Weight
23511.38
Theoretical pI
4.66
GO Classification
Processes
transport / inflammatory response / acute-phase response / negative regulation of tumor necrosis factor production / regulation of immune system process / negative regulation of interleukin-6 production
Components
extracellular region / extracellular space / extracellular exosome / blood microparticle
General Function
Not Available
Specific Function
Functions as transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain. Also binds synthetic drugs and influences their distribution and availability in the body. Appears to function in modulating the activity of the immune system during the acute-phase reaction.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0010649|Alpha-1-acid glycoprotein 1 (ORM1)
ATGGCGCTGTCCTGGGTTCTTACAGTCCTGAGCCTCCTACCTCTGCTGGAAGCCCAGATC
CCATTGTGTGCCAACCTAGTACCGGTGCCCATCACCAACGCCACCCTGGACCGGATCACT
GGCAAGTGGTTTTATATCGCATCGGCCTTTCGAAACGAGGAGTACAATAAGTCGGTTCAG
GAGATCCAAGCAACCTTCTTTTACTTCACCCCCAACAAGACAGAGGACACGATCTTTCTC
AGAGAGTACCAGACCCGACAGGACCAGTGCATCTATAACACCACCTACCTGAATGTCCAG
CGGGAAAATGGGACCATCTCCAGATACGTGGGAGGCCAAGAGCATTTCGCTCACTTGCTG
ATCCTCAGGGACACCAAGACCTACATGCTTGCTTTTGACGTGAACGATGAGAAGAACTGG
GGGCTGTCTGTCTATGCTGACAAGCCAGAGACGACCAAGGAGCAACTGGGAGAGTTCTAC
GAAGCTCTCGACTGCTTGCGCATTCCCAAGTCAGATGTCGTGTACACCGATTGGAAAAAG
GATAAGTGTGAGCCACTGGAGAAGCAGCACGAGAAGGAGAGGAAACAGGAGGAGGGGGAA
TCCTAG
Chromosome Location
9
Locus
9q31-q32
External Identifiers
ResourceLink
UniProtKB IDP02763
UniProtKB Entry NameA1AG1_HUMAN
GenBank Protein ID757907
GenBank Gene IDX02544
GenAtlas IDORM1
HGNC IDHGNC:8498
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00280Disopyramideapprovednoother/unknownDetails
DB00706Tamsulosinapproved, investigationalnoDetails
DB00908QuinidineapprovedunknownDetails
DB00946PhenprocoumonapprovednoDetails
DB01359Penbutololapproved, investigationalunknownother/unknownDetails
DB01429AprindineapprovedunknownDetails
DB01418AcenocoumarolapprovednoDetails
DB00682WarfarinapprovednoDetails
DB00802Alfentanilapproved, illicitunknownDetails
DB00540NortriptylineapprovednoDetails
DB00321AmitriptylineapprovednoDetails
DB01232Saquinavirapproved, investigationalunknownDetails
DB00334Olanzapineapproved, investigationalunknownDetails
DB01142Doxepinapprovedunknownother/unknownDetails
DB00543AmoxapineapprovednoDetails
DB00656Trazodoneapproved, investigationalnoDetails
DB00457PrazosinapprovednoDetails
DB00590DoxazosinapprovednoDetails
DB00571Propranololapproved, investigationalnoDetails
DB00458ImipramineapprovednoDetails
DB01151DesipramineapprovednoDetails
DB04821NomifensinewithdrawnnoDetails
DB01156BupropionapprovednoDetails
DB00934MaprotilineapprovednoDetails
DB01426AjmalineapprovedunknownDetails
DB00454PethidineapprovedunknownDetails
DB00731Nateglinideapproved, investigationalunknownDetails
DB08867UlipristalapprovednosubstrateDetails
DB05294VandetanibapprovedunknownbinderDetails
DB05521TelaprevirwithdrawnnosubstrateDetails
DB05812AbirateroneapprovedunknownsubstrateDetails
DB08881VemurafenibapprovedunknownsubstrateDetails
DB08828VismodegibapprovedunknownsubstrateDetails
DB08893MirabegronapprovednosubstrateDetails
DB08820IvacaftorapprovednocarrierDetails
DB08860PitavastatinapprovedunknownsubstrateDetails
DB08907CanagliflozinapprovedunknownsubstrateDetails
DB00482Celecoxibapproved, investigationalunknownsubstrateDetails
DB00530Erlotinibapproved, investigationalunknownsubstrateDetails
DB00472Fluoxetineapproved, vet_approvedunknownsubstrateDetails
DB00317Gefitinibapproved, investigationalunknownsubstrateDetails
DB00619ImatinibapprovedunknownsubstrateDetails
DB00864Tacrolimusapproved, investigationalunknownsubstrateDetails
DB08931RiociguatapprovedunknownsubstrateDetails
DB11575GrazoprevirapprovednosubstrateDetails
DB01685TopiroxostatapprovedunknownbinderDetails
DB00276AmsacrineapprovedunknownDetails
DB00396Progesteroneapproved, vet_approvedunknownDetails
DB00975DipyridamoleapprovedunknownDetails
DB00281Lidocaineapproved, vet_approvedunknownDetails
DB00477Chlorpromazineapproved, vet_approvedunknownbinderDetails
DB00497Oxycodoneapproved, illicit, investigationalunknownbinderDetails
DB01041Thalidomideapproved, investigational, withdrawnunknownbinderDetails
DB09262ImidafenacinapprovednosubstrateDetails
DB11828Neratinibapproved, investigationalnosubstrateDetails
DB00512VancomycinapprovednosubstrateDetails
DB12001AbemaciclibapprovedunknownbinderDetails