Protein TonB
Details
- Name
- Protein TonB
- Synonyms
- exbA
- Gene Name
- tonB
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0007686|Protein TonB MTLDLPRRFPWPTLLSVCIHGAVVAGLLYTSVHQVIELPAPAQPISVTMVTPADLEPPQA VQPPPEPVVEPEPEPEPIPEPPKEAPVVIEKPKPKPKPKPKPVKKVQEQPKRDVKPVESR PASPFENTAPARLTSSTATAATSKPVTSVASGPRALSRNQPQYPARAQALRIEGQVKVKF DVTPDGRVDNVQILSAKPANMFEREVKNAMRRWRYEPGKPGSGIVVNILFKINGTTEIQ
- Number of residues
- 239
- Molecular Weight
- 26094.07
- Theoretical pI
- 10.28
- GO Classification
- Functionsenergy transducer activity / siderophore transmembrane transporter activityProcessescobalamin transport / colicin transport / protein transport / siderophore transportComponentsintegral component of membrane / intrinsic component of external side of plasma membrane / outer membrane-bounded periplasmic space / plasma membrane
- General Function
- Siderophore transmembrane transporter activity
- Specific Function
- Interacts with outer membrane receptor proteins that carry out high-affinity binding and energy dependent uptake into the periplasmic space of specific substrates such as cobalamin, and various iron compounds (such as iron dicitrate, enterochelin, aerobactin, etc.). In the absence of TonB these receptors bind their substrates but do not carry out active transport. TonB also interacts with some colicins and is involved in the energy-dependent, irreversible steps of bacteriophages phi 80 and T1 infection. It could act to transduce energy from the cytoplasmic membrane to specific energy-requiring processes in the outer membrane, resulting in the release into the periplasm of ligands bound by these outer membrane proteins. Implicated in hydroxy radical-mediated cell death induced by hydroxyurea treatment (PubMed:20005847).
- Pfam Domain Function
- TonB (PF03544)
- Transmembrane Regions
- 1-32
- Cellular Location
- Cell inner membrane
- Gene sequence
>lcl|BSEQ0021696|Protein TonB (tonB) ATGACCCTTGATTTACCTCGCCGCTTCCCCTGGCCGACGTTACTTTCGGTCTGCATTCAT GGTGCTGTTGTGGCGGGTCTGCTCTATACCTCGGTACATCAGGTTATTGAACTACCTGCG CCTGCGCAGCCGATTTCTGTCACGATGGTTACGCCTGCTGATCTCGAACCGCCACAAGCC GTTCAGCCGCCACCGGAGCCGGTGGTAGAGCCAGAACCGGAACCTGAGCCGATCCCCGAA CCGCCAAAAGAAGCACCGGTGGTCATTGAAAAGCCGAAGCCGAAACCTAAGCCAAAACCG AAGCCGGTGAAAAAGGTACAGGAGCAGCCAAAACGCGATGTCAAACCCGTAGAGTCGCGT CCGGCATCACCGTTTGAAAATACGGCACCGGCACGCCTGACATCAAGTACAGCAACGGCT GCAACCAGCAAGCCGGTTACCAGTGTGGCTTCAGGACCACGCGCATTAAGCCGTAATCAG CCGCAGTATCCGGCACGAGCACAGGCATTGCGCATTGAAGGGCAGGTTAAAGTTAAATTT GACGTTACGCCGGATGGTCGCGTGGATAACGTACAAATCCTCTCAGCCAAGCCTGCGAAC ATGTTTGAGCGTGAGGTGAAAAATGCGATGCGCAGATGGCGTTATGAGCCGGGTAAGCCA GGCAGTGGGATTGTGGTGAATATCCTGTTTAAAATTAACGGCACCACCGAAATTCAGTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P02929 UniProtKB Entry Name TONB_ECOLI GenBank Protein ID 148023 GenBank Gene ID K00431 - General References
- Postle K, Good RF: DNA sequence of the Escherichia coli tonB gene. Proc Natl Acad Sci U S A. 1983 Sep;80(17):5235-9. [Article]
- Aiba H, Baba T, Hayashi K, Inada T, Isono K, Itoh T, Kasai H, Kashimoto K, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Horiuchi T, et al.: A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map. DNA Res. 1996 Dec 31;3(6):363-77. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Roof SK, Allard JD, Bertrand KP, Postle K: Analysis of Escherichia coli TonB membrane topology by use of PhoA fusions. J Bacteriol. 1991 Sep;173(17):5554-7. [Article]
- Karlsson M, Hannavy K, Higgins CF: A sequence-specific function for the N-terminal signal-like sequence of the TonB protein. Mol Microbiol. 1993 Apr;8(2):379-88. [Article]
- Davies BW, Kohanski MA, Simmons LA, Winkler JA, Collins JJ, Walker GC: Hydroxyurea induces hydroxyl radical-mediated cell death in Escherichia coli. Mol Cell. 2009 Dec 11;36(5):845-60. doi: 10.1016/j.molcel.2009.11.024. [Article]
- Chang C, Mooser A, Pluckthun A, Wlodawer A: Crystal structure of the dimeric C-terminal domain of TonB reveals a novel fold. J Biol Chem. 2001 Jul 20;276(29):27535-40. Epub 2001 Apr 27. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB03017 Lauric acid approved, experimental unknown Details DB02767 (R)-3-hydroxytetradecanoic acid experimental unknown Details DB04147 Dodecyldimethylamine N-oxide experimental unknown Details DB08231 Myristic acid experimental unknown Details