Cytochrome P450 3A1
Details
- Name
- Cytochrome P450 3A1
- Synonyms
- 1.14.14.1
- Cyp3a-1
- CYPIIIA1
- Cytochrome P450-PCN1
- Gene Name
- Cyp3a1
- Organism
- Rat
- Amino acid sequence
>lcl|BSEQ0020792|Cytochrome P450 3A1 MDLLSALTLETWVLLAVVLVLLYGFGTRTHGLFKKQGIPGPKPLPFFGTVLNYYMGLWKF DVECHKKYGKIWGLFDGQMPLFAITDTEMIKNVLVKECFSVFTNRRDFGPVGIMGKAVSV AKDEEWKRYRALLSPTFTSGRLKEMFPIIEQYGDILVKYLKQEAETGKPVTMKKVFGAYS MDVITSTSFGVNVDSLNNPKDPFVEKTKKLLRFDFFDPLFLSVVLFPFLTPIYEMLNICM FPKDSIEFFKKFVYRMKETRLDSVQKHRVDFLQLMMNAHNDSKDKESHTALSDMEITAQS IIFIFAGYEPTSSTLSFVLHSLATHPDTQKKLQEEIDRALPNKAPPTYDTVMEMEYLDMV LNETLRLYPIGNRLERVCKKDVEINGVFMPKGSVVMIPSYALHRDPQHWPEPEEFRPERF SKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSFQPCKETQIPLKLSR QGLLQPTKPIILKVVPRDEIITGS
- Number of residues
- 504
- Molecular Weight
- 57917.375
- Theoretical pI
- Not Available
- GO Classification
- Functionsaromatase activity / demethylase activity / heme binding / iron ion binding / testosterone 6-beta-hydroxylase activityProcessesaging / drug metabolic process / oxidative demethylation / response to cadmium ion / response to drug / response to glucocorticoid / response to metal ion / response to nutrientComponentsendoplasmic reticulum membrane / intracellular membrane-bounded organelle
- General Function
- Testosterone 6-beta-hydroxylase activity
- Specific Function
- Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
- Pfam Domain Function
- p450 (PF00067)
- Transmembrane Regions
- Not Available
- Cellular Location
- Endoplasmic reticulum membrane
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P04800 UniProtKB Entry Name CP3A1_RAT - General References
- Gonzalez FJ, Nebert DW, Hardwick JP, Kasper CB: Complete cDNA and protein sequence of a pregnenolone 16 alpha-carbonitrile-induced cytochrome P-450. A representative of a new gene family. J Biol Chem. 1985 Jun 25;260(12):7435-41. [Article]
- Ribeiro V, Lechner MC: Cloning and characterization of a novel CYP3A1 allelic variant: analysis of CYP3A1 and CYP3A2 sex-hormone-dependent expression reveals that the CYP3A2 gene is regulated by testosterone. Arch Biochem Biophys. 1992 Feb 14;293(1):147-52. [Article]
- Nagata K, Gonzalez FJ, Yamazoe Y, Kato R: Purification and characterization of four catalytically active testosterone 6 beta-hydroxylase P-450s from rat liver microsomes: comparison of a novel form with three structurally and functionally related forms. J Biochem. 1990 May;107(5):718-25. [Article]
- Cooper KO, Reik LM, Jayyosi Z, Bandiera S, Kelley M, Ryan DE, Daniel R, McCluskey SA, Levin W, Thomas PE: Regulation of two members of the steroid-inducible cytochrome P450 subfamily (3A) in rats. Arch Biochem Biophys. 1993 Mar;301(2):345-54. [Article]
- Burger HJ, Schuetz JD, Schuetz EG, Guzelian PS: Paradoxical transcriptional activation of rat liver cytochrome P-450 3A1 by dexamethasone and the antiglucocorticoid pregnenolone 16 alpha-carbonitrile: analysis by transient transfection into primary monolayer cultures of adult rat hepatocytes. Proc Natl Acad Sci U S A. 1992 Mar 15;89(6):2145-9. [Article]
- Telhada MB, Pereira TM, Lechner MC: Effect of dexamethasone and phenobarbital on run-on transcription rate and CYP3A mRNA concentration in rat liver: changes during development. Arch Biochem Biophys. 1992 Nov 1;298(2):715-25. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB08834 Tauroursodeoxycholic acid approved, investigational unknown inducer Details DB13746 Bioallethrin approved, experimental no substrate Details DB01645 Genistein investigational unknown substrate Details DB00603 Medroxyprogesterone acetate approved, investigational unknown substrate Details