Cytochrome P450 1A2

Details

Name
Cytochrome P450 1A2
Synonyms
  • 1.14.14.1
  • Cholesterol 25-hydroxylase
  • CYPIA2
  • Cytochrome P(3)450
  • Cytochrome P450 4
  • Cytochrome P450-P3
Gene Name
CYP1A2
Organism
Human
Amino acid sequence
>lcl|BSEQ0004778|Cytochrome P450 1A2
MALSQSVPFSATELLLASAIFCLVFWVLKGLRPRVPKGLKSPPEPWGWPLLGHVLTLGKN
PHLALSRMSQRYGDVLQIRIGSTPVLVLSRLDTIRQALVRQGDDFKGRPDLYTSTLITDG
QSLTFSTDSGPVWAARRRLAQNALNTFSIASDPASSSSCYLEEHVSKEAKALISRLQELM
AGPGHFDPYNQVVVSVANVIGAMCFGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFP
ILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGN
LIPQEKIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTVIGRERRPRLS
DRPQLPYLEAFILETFRHSSFLPFTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPEL
WEDPSEFRPERFLTADGTAINKPLSEKMMLFGMGKRRCIGEVLAKWEIFLFLAILLQQLE
FSVPPGVKVDLTPIYGLTMKHARCEHVQARRFSIN
Number of residues
515
Molecular Weight
58293.76
Theoretical pI
9.43
GO Classification
Functions
oxidoreductase activity / iron ion binding / heme binding / monooxygenase activity / aromatase activity / oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen / caffeine oxidase activity / enzyme binding / demethylase activity / electron carrier activity
Processes
porphyrin-containing compound metabolic process / dibenzo-p-dioxin metabolic process / lung development / methylation / drug catabolic process / post-embryonic development / epoxygenase P450 pathway / heterocycle metabolic process / exogenous drug catabolic process / hydrogen peroxide biosynthetic process / oxidation-reduction process / steroid catabolic process / cellular respiration / monoterpenoid metabolic process / regulation of gene expression / omega-hydroxylase P450 pathway / response to lipopolysaccharide / monocarboxylic acid metabolic process / oxidative deethylation / response to immobilization stress / oxidative demethylation / xenobiotic metabolic process / toxin biosynthetic process / arachidonic acid metabolic process / alkaloid metabolic process / small molecule metabolic process / drug metabolic process / cellular response to cadmium ion / response to estradiol
Components
intracellular membrane-bounded organelle / endoplasmic reticulum membrane
General Function
Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
Specific Function
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Most active in catalyzing 2-hydroxylation. Caffeine is metabolized primarily by cytochrome CYP1A2 in the liver through an initial N3-demethylation. Also acts in the metabolism of aflatoxin B1 and acetaminophen. Participates in the bioactivation of carcinogenic aromatic and heterocyclic amines. Catalizes the N-hydroxylation of heterocyclic amines and the O-deethylation of phenacetin.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Endoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0011742|Cytochrome P450 1A2 (CYP1A2)
ATGGCATTGTCCCAGTCTGTTCCCTTCTCGGCCACAGAGCTTCTCCTGGCCTCTGCCATC
TTCTGCCTGGTATTCTGGGTGCTCAAGGGTTTGAGGCCTCGGGTCCCCAAAGGCCTGAAA
AGTCCACCAGAGCCATGGGGCTGGCCCTTGCTCGGGCATGTGCTGACCCTGGGGAAGAAC
CCGCACCTGGCACTGTCAAGGATGAGCCAGCGCTACGGGGACGTCCTGCAGATCCGCATT
GGCTCCACGCCCGTGCTGGTGCTGAGCCGCCTGGACACCATCCGGCAGGCCCTGGTGCGG
CAGGGCGACGATTTCAAGGGCCGGCCTGACCTCTACACCTCCACCCTCATCACTGATGGC
CAGAGCTTGACCTTCAGCACAGACTCTGGACCGGTGTGGGCTGCCCGCCGGCGCCTGGCC
CAGAATGCCCTCAACACCTTCTCCATCGCCTCTGACCCAGCTTCCTCATCCTCCTGCTAC
CTGGAGGAGCATGTGAGCAAGGAGGCTAAGGCCCTGATCAGCAGGTTGCAGGAGCTGATG
GCAGGGCCTGGGCACTTCGACCCTTACAATCAGGTGGTGGTGTCAGTGGCCAACGTCATT
GGTGCCATGTGCTTCGGACAGCACTTCCCTGAGAGTAGCGATGAGATGCTCAGCCTCGTG
AAGAACACTCATGAGTTCGTGGAGACTGCCTCCTCCGGGAACCCCCTGGACTTCTTCCCC
ATCCTTCGCTACCTGCCTAACCCTGCCCTGCAGAGGTTCAAGGCCTTCAACCAGAGGTTC
CTGTGGTTCCTGCAGAAAACAGTCCAGGAGCACTATCAGGACTTTGACAAGAACAGTGTC
CGGGACATCACGGGTGCCCTGTTCAAGCACAGCAAGAAGGGGCCTAGAGCCAGCGGCAAC
CTCATCCCACAGGAGAAGATTGTCAACCTTGTCAATGACATCTTTGGAGCAGGATTTGAC
ACAGTCACCACAGCCATCTCCTGGAGCCTCATGTACCTTGTGACCAAGCCTGAGATACAG
AGGAAGATCCAGAAGGAGCTGGACACTGTGATTGGCAGGGAGCGGCGGCCCCGGCTCTCT
GACAGACCCCAGCTGCCCTACTTGGAGGCCTTCATCCTGGAGACCTTCCGACACTCCTCC
TTCTTGCCCTTCACCATCCCCCACAGCACAACAAGGGACACAACGCTGAATGGCTTCTAC
ATCCCCAAGAAATGCTGTGTCTTCGTAAACCAGTGGCAGGTCAACCATGACCCAGAGCTG
TGGGAGGACCCCTCTGAGTTCCGGCCTGAGCGGTTCCTCACCGCCGATGGCACTGCCATT
AACAAGCCCTTGAGTGAGAAGATGATGCTGTTTGGCATGGGCAAGCGCCGGTGTATCGGG
GAAGTCCTGGCCAAGTGGGAGATCTTCCTCTTCCTGGCCATCCTGCTACAGCAACTGGAG
TTCAGCGTGCCGCCGGGCGTGAAAGTCGACCTGACCCCCATCTACGGGCTGACCATGAAG
CACGCCCGCTGTGAACATGTCCAGGCGCGGCTGCGCTTCTCCATCAATTGA
Chromosome Location
15
Locus
15q24
External Identifiers
ResourceLink
UniProtKB IDP05177
UniProtKB Entry NameCP1A2_HUMAN
GenBank Gene IDZ00036
GenAtlas IDCYP1A2
HGNC IDHGNC:2596
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00176Fluvoxamineapproved, investigationalunknownsubstrateinhibitorDetails
DB00188Bortezomibapproved, investigationalnosubstrateinhibitorDetails
DB00201CaffeineapprovedunknownsubstrateinhibitorDetails
DB00261AnagrelideapprovedunknownsubstrateinhibitorDetails
DB00262Carmustineapproved, investigationalunknownsubstrateDetails
DB00268Ropiniroleapproved, investigationalunknownsubstrateDetails
DB00277TheophyllineapprovedunknownsubstrateDetails
DB00281Lidocaineapproved, vet_approvedunknownsubstrateinhibitorDetails
DB00286Conjugated estrogensapprovedunknownsubstrateinhibitorDetails
DB00296RopivacaineapprovedunknownsubstrateDetails
DB00315Zolmitriptanapproved, investigationalunknownsubstrateDetails
DB00316AcetaminophenapprovedunknownsubstrateDetails
DB00321AmitriptylineapprovedunknownsubstrateDetails
DB00334Olanzapineapproved, investigationalunknownsubstrateDetails
DB00363ClozapineapprovedunknownsubstrateinhibitorDetails
DB00365Grepafloxacinapproved, investigational, withdrawnunknownsubstrateDetails
DB00370MirtazapineapprovedunknownsubstrateDetails
DB00379Mexiletineapproved, investigationalunknownsubstrateinhibitorDetails
DB00382Tacrineapproved, investigational, withdrawnunknownsubstrateDetails
DB00458ImipramineapprovedunknownsubstrateinhibitorDetails
DB00476DuloxetineapprovedunknownsubstrateDetails
DB00499Flutamideapproved, investigationalunknownsubstrateDetails
DB00502HaloperidolapprovedunknownsubstrateDetails
DB00537Ciprofloxacinapproved, investigationalunknowninhibitorDetails
DB00540NortriptylineapprovedunknownsubstrateDetails
DB00544FluorouracilapprovedunknownsubstrateDetails
DB00571Propranololapproved, investigationalunknownsubstrateDetails
DB00655EstroneapprovedunknownsubstrateDetails
DB00661VerapamilapprovedunknownsubstrateDetails
DB00682WarfarinapprovedunknownsubstrateDetails
DB00697Tizanidineapproved, investigationalunknownsubstrateDetails
DB00740Riluzoleapproved, investigationalunknownsubstrateDetails
DB00744Zileutonapproved, investigational, withdrawnunknownsubstrateDetails
DB00783Estradiolapproved, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB00851Dacarbazineapproved, investigationalunknownsubstrateDetails
DB00863RanitidineapprovedunknownsubstrateDetails
DB00904OndansetronapprovedunknownsubstrateinhibitorDetails
DB00924CyclobenzaprineapprovedunknownsubstrateDetails
DB00978Lomefloxacinapproved, investigationalunknownsubstrateinhibitorDetails
DB00980Ramelteonapproved, investigationalunknownsubstrateDetails
DB00998Frovatriptanapproved, investigationalunknownsubstrateDetails
DB01002Levobupivacaineapproved, investigationalunknownsubstrateDetails
DB01012CinacalcetapprovedunknownsubstrateDetails
DB01094HesperetinexperimentalunknownsubstrateDetails
DB01097Leflunomideapproved, investigationalunknownsubstrateDetails
DB01100PimozideapprovedunknownsubstrateDetails
DB01137Levofloxacinapproved, investigationalunknowninhibitorDetails
DB01165OfloxacinapprovedunknowninhibitorDetails
DB01182PropafenoneapprovedunknownsubstrateinhibitorDetails
DB01242Clomipramineapproved, investigational, vet_approvedunknownsubstrateDetails
DB00969Alosetronapproved, withdrawnunknownsubstrateinhibitorDetails
DB01367RasagilineapprovedunknownsubstrateDetails
DB00356ChlorzoxazoneapprovedunknownsubstrateDetails
DB00467Enoxacinapproved, investigationalunknowninhibitorDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknownsubstrateDetails
DB00487PefloxacinapprovedunknowninhibitorDetails
DB00501Cimetidineapproved, investigationalunknowninhibitorDetails
DB00532Mephenytoinapproved, investigational, withdrawnunknownsubstrateDetails
DB00533Rofecoxibapproved, investigational, withdrawnunknownsubstrateinhibitorDetails
DB00586Diclofenacapproved, vet_approvedunknownsubstrateDetails
DB00730Thiabendazoleapproved, vet_approvedunknownsubstrateinhibitorDetails
DB00908Quinidineapproved, investigationalunknowninhibitorDetails
DB00967Desloratadineapproved, investigationalunknowninhibitorDetails
DB00972AzelastineapprovedunknownsubstrateDetails
DB01026Ketoconazoleapproved, investigationalunknowninhibitorDetails
DB01045RifampicinapprovedunknowninducerDetails
DB01059NorfloxacinapprovedunknowninhibitorDetails
DB01418Acenocoumarolapproved, investigationalunknownsubstrateDetails
DB01424Aminophenazoneapproved, withdrawnunknownsubstrateDetails
DB00377Palonosetronapproved, investigationalunknownsubstrateDetails
DB05708GTS-21investigationalunknownDetails
DB06442AvasimibeinvestigationalunknownDetails
DB01065Melatoninapproved, nutraceutical, vet_approvedunknownsubstrateDetails
DB01115NifedipineapprovedunknownsubstrateDetails
DB00619ImatinibapprovedunknownsubstrateDetails
DB00468QuinineapprovedunknownsubstrateinhibitorDetails
DB01142Doxepinapproved, investigationalunknownsubstrateDetails
DB00564Carbamazepineapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB00425ZolpidemapprovedunknownsubstrateDetails
DB00951Isoniazidapproved, investigationalunknowninhibitorDetails
DB00472Fluoxetineapproved, vet_approvedunknownsubstrateDetails
DB01435Antipyrineapproved, investigationalunknownsubstrateDetails
DB01118Amiodaroneapproved, investigationalunknownsubstrateinhibitorDetails
DB00857Terbinafineapproved, investigational, vet_approvedunknownsubstrateDetails
DB00568Cinnarizineapproved, investigationalunknownsubstrateDetails
DB04841FlunarizineapprovedunknownsubstrateDetails
DB00788Naproxenapproved, vet_approvedunknownsubstrateDetails
DB03783PhenacetinwithdrawnunknownsubstrateDetails
DB00553MethoxsalenapprovedunknowninhibitorDetails
DB01388Mibefradilinvestigational, withdrawnunknowninhibitorDetails
DB00745Modafinilapproved, investigationalunknowninducerDetails
DB00607Nafcillinapproved, investigationalunknowninducerDetails
DB06732beta-NaphthoflavoneexperimentalunknowninducerDetails
DB00338Omeprazoleapproved, investigational, vet_approvedunknowninhibitorinducerDetails
DB01223AminophyllineapprovedunknownsubstrateDetails
DB06216AsenapineapprovedunknownsubstrateDetails
DB00195Betaxololapproved, investigationalunknownsubstrateDetails
DB04574Estrone sulfateapprovedunknownsubstrateinhibitorDetails
DB00629Guanabenzapproved, investigationalunknownsubstrateDetails
DB01623ThiothixeneapprovedunknownsubstrateDetails
DB00831Trifluoperazineapproved, investigationalunknownsubstrateDetails
DB01174Phenobarbitalapproved, investigationalunknowninducerDetails
DB00794Primidoneapproved, vet_approvedunknowninducerDetails
DB01241GemfibrozilapprovedunknowninhibitorDetails
DB00752Tranylcypromineapproved, investigationalunknowninhibitorDetails
DB01087PrimaquineapprovedunknownsubstrateinhibitorinducerDetails
DB00758ClopidogrelapprovedunknownsubstrateDetails
DB00420Promazineapproved, vet_approvedunknownsubstrateinhibitorDetails
DB01136Carvedilolapproved, investigationalunknownsubstrateDetails
DB01628Etoricoxibapproved, investigationalunknownsubstrateDetails
DB01645GenisteininvestigationalunknownsubstrateinhibitorDetails
DB074532-PHENYL-4H-BENZO[H]CHROMEN-4-ONEexperimentalunknownDetails
DB02709Resveratrolapproved, experimental, investigationalunknownsubstrateinhibitorDetails
DB00518Albendazoleapproved, vet_approvedunknowninducerDetails
DB01217Anastrozoleapproved, investigationalunknowninhibitorDetails
DB01558Bromazepamapproved, illicit, investigationalunknownsubstrateDetails
DB00215CitalopramapprovedunknowninhibitorDetails
DB00882Clomifeneapproved, investigationalunknowninhibitorDetails
DB01151Desipramineapproved, investigationalunknownsubstrateDetails
DB01191Dexfenfluramineapproved, illicit, investigational, withdrawnunknownsubstrateDetails
DB01184Domperidoneapproved, investigational, vet_approvedunknownsubstrateDetails
DB00625Efavirenzapproved, investigationalunknowninhibitorDetails
DB00898EthanolapprovedunknownsubstrateDetails
DB00773EtoposideapprovedunknownsubstrateDetails
DB00400Griseofulvinapproved, investigational, vet_approvedunknowninducerDetails
DB01283Lumiracoxibapproved, investigationalunknownsubstrateDetails
DB00772Malathionapproved, investigationalunknownsubstrateDetails
DB00934Maprotilineapproved, investigationalunknownsubstrateDetails
DB00170Menadioneapproved, nutraceuticalunknowninducerDetails
DB00333MethadoneapprovedunknownsubstrateDetails
DB01028Methoxyfluraneapproved, investigational, vet_approvedunknownsubstrateDetails
DB06148Mianserinapproved, investigationalunknownsubstrateDetails
DB00184NicotineapprovedunknowninducerDetails
DB00806Pentoxifyllineapproved, investigationalunknownsubstrateDetails
DB00850PerphenazineapprovedunknownsubstrateDetails
DB00191Phentermineapproved, illicitunknowninhibitorDetails
DB00388PhenylephrineapprovedunknowninducerDetails
DB01058Praziquantelapproved, investigational, vet_approvedunknownsubstrateDetails
DB00818Propofolapproved, investigational, vet_approvedunknowninhibitorDetails
DB01129Rabeprazoleapproved, investigationalunknowninducerDetails
DB00503Ritonavirapproved, investigationalunknowninhibitorinducerDetails
DB00412Rosiglitazoneapproved, investigationalunknowninhibitorDetails
DB01037Selegilineapproved, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB01079Tegaserodapproved, investigational, withdrawnunknowninhibitorDetails
DB01405TemafloxacinwithdrawnunknownsubstrateDetails
DB01412TheobromineinvestigationalunknownsubstrateDetails
DB00763MethimazoleapprovedunknowninhibitorDetails
DB00208TiclopidineapprovedunknowninhibitorDetails
DB06264TolperisoneinvestigationalunknownsubstrateDetails
DB00384TriamtereneapprovedunknownsubstrateDetails
DB00313Valproic Acidapproved, investigationalunknowninhibitorDetails
DB00549Zafirlukastapproved, investigationalunknowninhibitorDetails
DB00246ZiprasidoneapprovedunknownsubstrateDetails
DB01303OxtriphyllineapprovedunknownsubstrateDetails
DB00398Sorafenibapproved, investigationalunknownsubstrateDetails
DB00418Secobarbitalapproved, vet_approvedunknowninducerDetails
DB00530Erlotinibapproved, investigationalunknownsubstrateDetails
DB01166Cilostazolapproved, investigationalunknownsubstrateDetails
DB01254Dasatinibapproved, investigationalunknownsubstrateDetails
DB06210EltrombopagapprovedunknownsubstrateDetails
DB06413Armodafinilapproved, investigationalunknowninducerDetails
DB00575ClonidineapprovedunknownsubstrateDetails
DB06594Agomelatineapproved, investigationalunknownsubstrateDetails
DB06510MuraglitazarinvestigationalunknownsubstrateDetails
DB06770Benzyl alcoholapprovedunknownsubstrateDetails
DB06774CapsaicinapprovedunknownsubstrateinducerDetails
DB00633Dexmedetomidineapproved, vet_approvedunknowninhibitorDetails
DB06235VadimezaninvestigationalunknownsubstrateDetails
DB00461NabumetoneapprovedunknownsubstrateDetails
DB06803Niclosamideapproved, investigational, vet_approvedunknowninhibitorDetails
DB00435Nitric OxideapprovedunknowninhibitorDetails
DB06820SulconazoleapprovedunknowninhibitorDetails
DB00428Streptozocinapproved, investigationalunknowninducerDetails
DB06589PazopanibapprovedunknownsubstrateDetails
DB08867UlipristalapprovednosubstrateDetails
DB04871LorcaserinapprovednosubstrateDetails
DB08881VemurafenibapprovedunknowninhibitorDetails
DB06605ApixabanapprovedunknownsubstrateDetails
DB06626Axitinibapproved, investigationalnosubstrateDetails
DB08910PomalidomideapprovedunknownsubstrateDetails
DB06290SimeprevirapprovednoinhibitorDetails
DB06292DapagliflozinapprovednoinhibitorDetails
DB00951Isoniazidapproved, investigationalunknownDetails
DB05812AbirateroneapprovedunknowninhibitorDetails
DB09570Ixazomibapproved, investigationalunknownsubstrateDetails
DB09330OsimertinibapprovednoinducerDetails
DB06769Bendamustineapproved, investigationalnosubstrateDetails
DB00105Interferon Alfa-2b, RecombinantapprovedunknowninhibitorDetails
DB05990Obeticholic acidapprovedunknowninhibitorDetails
DB01173OrphenadrineapprovedunknowninhibitorDetails
DB00715Paroxetineapproved, investigationalunknowninhibitorDetails
DB00008Peginterferon alfa-2aapproved, investigationalunknowninhibitorDetails
DB00022Peginterferon alfa-2bapprovedunknowninhibitorDetails
DB12332Rucaparibapproved, investigationalyessubstrateinhibitorinducerDetails
DB11737Icotinibexperimental, investigationalunknownsubstrateDetails
DB12161Deutetrabenazineapproved, investigationalyessubstrateDetails
DB06595Midostaurinapproved, investigationalunknowninhibitorinducerDetails
DB05015Belinostatapproved, investigationalunknowninducerDetails
DB13174RheinexperimentalunknowninhibitorDetails
DB11994Diacereinapproved, investigationalunknowninhibitorDetails
DB09120Zucapsaicinapproved, investigationalunknowninhibitorDetails
DB09118StiripentolapprovedunknownsubstrateinhibitorDetails
DB09198LobeglitazoneexperimentalnoinhibitorDetails
DB09167DosulepinapprovedunknowninhibitorDetails
DB12026Voxilaprevirapproved, investigationalnosubstrateDetails
DB13874Enasidenibapproved, investigationalunknownsubstrateinhibitorDetails
DB09061Cannabidiolapproved, investigationalunknownDetails
DB13952Estradiol acetateapproved, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB13953Estradiol benzoateapproved, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB13954Estradiol cypionateapproved, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB13955Estradiol dienanthateapproved, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB13956Estradiol valerateapproved, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB09225Zotepineapproved, investigational, withdrawnnosubstrateDetails
DB11642Pitolisantapproved, investigationalunknowninducerDetails
DB09328Vayarinapproved, investigationalunknownDetails
DB13975Cimicifuga racemosaapproved, experimentalnoinhibitorDetails
DB14011NabiximolsinvestigationalunknownDetails
DB14009Medical Cannabisexperimental, investigationalunknownDetails
DB11198Peppermint oilapproved, investigationalunknowninhibitorDetails
DB04948Lofexidineapproved, investigationalnosubstrateDetails
DB11672Curcuminapproved, experimental, investigationalunknowninhibitorDetails
DB00238NevirapineapprovedunknownDetails
DB11967Binimetinibapproved, investigationalunknownsubstrateDetails
DB06654Safinamideapproved, investigationalunknowninhibitorDetails
DB08883PerampanelapprovedunknownDetails
DB09078Lenvatinibapproved, investigationalunknowninhibitorDetails
DB05928DovitinibinvestigationalunknowninducerDetails
DB08496(R)-warfarinexperimentalunknownsubstrateDetails
DB141328-chlorotheophyllineexperimentalnosubstrateDetails
DB01320Fosphenytoinapproved, investigationalunknowninducerDetails
DB00993AzathioprineapprovednosubstrateDetails
DB14029FurafyllineexperimentalnoinhibitorDetails
DB04076HypoxanthineexperimentalnosubstrateDetails
DB12406LisofyllineinvestigationalnosubstrateDetails
DB02134XanthineexperimentalnosubstrateDetails
DB06771BesifloxacinapprovednoinhibitorDetails
DB00827Cinoxacinapproved, investigational, withdrawnnoinhibitorDetails
DB04576FleroxacinexperimentalnoinhibitorDetails
DB06160GarenoxacininvestigationalnoinhibitorDetails
DB01044Gatifloxacinapproved, investigationalnoinhibitorDetails
DB01155Gemifloxacinapproved, investigationalnoinhibitorDetails
DB00218Moxifloxacinapproved, investigationalnoinhibitorDetails
DB06600NemonoxacininvestigationalnoinhibitorDetails
DB13627Oxolinic acidexperimentalnoinhibitorDetails
DB11774PazufloxacininvestigationalnoinhibitorDetails
DB11892PrulifloxacininvestigationalnoinhibitorDetails
DB00817Rosoxacinapproved, investigationalnoinhibitorDetails
DB13772RufloxacinexperimentalnoinhibitorDetails
DB11491Sarafloxacinvet_approved, withdrawnnoinhibitorDetails
DB13261Sitafloxacinexperimental, investigationalnoinhibitorDetails
DB01208Sparfloxacinapproved, investigational, withdrawnunknowninhibitorDetails
DB05488Technetium Tc-99m ciprofloxacininvestigationalnoinhibitorDetails
DB00685Trovafloxacinapproved, investigational, withdrawnnoinhibitorDetails
DB016678-azaguanineexperimentalnosubstrateDetails
DB043569-DeazaguanineexperimentalnosubstrateDetails
DB024899-MethylguanineexperimentalnosubstrateDetails
DB13203BamifyllineexperimentalnosubstrateDetails
DB14018BromotheophyllineapprovednosubstrateDetails
DB09273DoxofyllineexperimentalnosubstrateDetails
DB01482FenethyllineexperimentalnosubstrateDetails
DB06479PropentofyllineinvestigationalunknownsubstrateDetails
DB09256Tegafurapproved, investigationalunknownsubstrateDetails
DB14600Edetate disodium anhydrousapproved, vet_approvedunknownDetails
DB09288PropacetamolexperimentalnosubstrateDetails
DB14635Curcumin sulfateexperimentalunknownDetails
DB00280DisopyramideapprovedunknownsubstrateDetails
DB00454MeperidineapprovedunknowninducerDetails
DB09290RamosetroninvestigationalunknownsubstrateDetails
DB09071Tasimelteonapproved, investigationalunknownDetails
DB04951Pirfenidoneapproved, investigationalunknownsubstrateinhibitorDetails
DB12945Dihydralazineapproved, experimentalunknownsubstrateinhibitorDetails
DB08880TeriflunomideapprovedunknowninducerDetails
DB01609Deferasiroxapproved, investigationalunknowninhibitorDetails
DB08972FlumequinewithdrawnunknowninhibitorDetails