Gag polyprotein
Details
- Name
- Gag polyprotein
- Synonyms
- Pr55Gag
- Gene Name
- gag
- Organism
- SIV-mac
- Amino acid sequence
>lcl|BSEQ0005345|Gag polyprotein MGARNAVLSGKKADELEKIRLRPGGKKKYMLKHVVWAANELDRFGLAESLLENKEGCQKI LSVLAPLVPTGSENLKSLYNTVCVIWCIHAEEKVKHTEEAKQIVQRHLVVETGTAETMPK TSRPTAPSSGRGGNYPVQQIGGNYVHLPLSPRTLNAWVKLIEEKKFGAEVVPGFQALSEG CTPYDINQMLNCVGDHQAAMQIIRDIINEEAADWDLQHPQPAPQQGQLREPSGSDIAGTT SSVDEQIQWMYRQQNPIPVGNIYRRWIQLRLQKCVRMYNPINILDVKQRPKEPFQSYVDR FYKSLRAEQTDAAVKNWMTQTLLIQNANPDCKLVLKGLGVNPTLEEMLTACQGVGGPGQK ARLMAEALKEALRPVPTPFAAAQQRGPRKPIKCWNCGKEGHSARQCRAPRRQRCWKCGKM DHVMAKCPDRQAGFLGLGPWGKKPRNFPMAQVHQGLTPTAPPEDPAVDLLKNYMQLGKQQ RESREKPYKEVTEDLLHLNSLFGGDQ
- Number of residues
- 506
- Molecular Weight
- 56725.035
- Theoretical pI
- 9.42
- GO Classification
- FunctionsRNA binding / structural molecule activity / zinc ion bindingProcessesviral budding via host ESCRT complex / viral release from host cellComponentshost cell cytoplasm / host cell nucleus / host cell plasma membrane / membrane / viral nucleocapsid
- General Function
- Zinc ion binding
- Specific Function
- Matrix protein p17 targets Gag and Gag-Pol polyproteins to the plasma membrane via a multipartite membrane binding signal, that includes its myristoylated N-terminus. Also mediates nuclear localization of the preintegration complex. Implicated in the release from host cell mediated by Vpu (By similarity).Capsid protein p24 forms the conical core of the virus that encapsulates the genomic RNA-nucleocapsid complex.Nucleocapsid protein p7 encapsulates and protects viral dimeric unspliced (genomic) RNA. Binds these RNAs through its zinc fingers (By similarity).p6-gag plays a role in budding of the assembled particle by interacting with the host class E VPS proteins TSG101 and PDCD6IP/AIP1.
- Pfam Domain Function
- Transmembrane Regions
- Not Available
- Cellular Location
- Virion
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P05893 UniProtKB Entry Name GAG_SIVMK - General References
- Franchini G, Gurgo C, Guo HG, Gallo RC, Collalti E, Fargnoli KA, Hall LF, Wong-Staal F, Reitz MS Jr: Sequence of simian immunodeficiency virus and its relationship to the human immunodeficiency viruses. Nature. 1987 Aug 6-12;328(6130):539-43. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details