Macrophage colony-stimulating factor 1 receptor

Details

Name
Macrophage colony-stimulating factor 1 receptor
Synonyms
  • CSF-1 receptor
  • CSF-1-R
  • CSF-1R
  • FMS
  • M-CSF-R
  • Proto-oncogene c-Fms
Gene Name
CSF1R
Organism
Human
Amino acid sequence
>lcl|BSEQ0001700|Macrophage colony-stimulating factor 1 receptor
MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTL
YSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED
QDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSAL
MGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHN
NTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAY
LNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTY
RHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCA
ASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHN
QTYECRAHNSVGSGSWAFIPISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKY
KQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEAT
AFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVL
VITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVRRDSGFSSQGV
DTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVA
ARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWS
YGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHR
PTFQQICSFLQEQAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIA
QPLLQPNNYQFC
Number of residues
972
Molecular Weight
107982.955
Theoretical pI
6.33
GO Classification
Functions
macrophage colony-stimulating factor receptor activity / ATP binding / cytokine binding / protein homodimerization activity
Processes
positive regulation of cell proliferation / positive regulation of chemokine secretion / axon guidance / cytokine-mediated signaling pathway / signal transduction / cell-cell junction maintenance / positive regulation of osteoclast differentiation / innate immune response / phosphatidylinositol metabolic process / cellular response to macrophage colony-stimulating factor stimulus / peptidyl-tyrosine phosphorylation / positive regulation of protein serine/threonine kinase activity / phosphatidylinositol-mediated signaling / transmembrane receptor protein tyrosine kinase signaling pathway / forebrain neuron differentiation / positive regulation of protein phosphorylation / positive regulation of protein tyrosine kinase activity / positive regulation of ERK1 and ERK2 cascade / hemopoiesis / regulation of actin cytoskeleton reorganization / regulation of bone resorption / protein autophosphorylation / macrophage colony-stimulating factor signaling pathway / ruffle organization / macrophage differentiation / inflammatory response / mammary gland duct morphogenesis / positive regulation of cell migration / positive regulation of tyrosine phosphorylation of Stat3 protein / regulation of cell shape / monocyte differentiation / negative regulation of apoptotic process / skeletal muscle tissue development / olfactory bulb development / negative regulation of cell proliferation / cellular response to cytokine stimulus / osteoclast differentiation / cell proliferation / multicellular organismal development / positive regulation of cell motility
Components
intracellular / plasma membrane / integral component of plasma membrane / cell surface / CSF1-CSF1R complex
General Function
Protein homodimerization activity
Specific Function
Tyrosine-protein kinase that acts as cell-surface receptor for CSF1 and IL34 and plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines in response to IL34 and CSF1, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone and tooth development. Required for normal male and female fertility, and for normal development of milk ducts and acinar structures in the mammary gland during pregnancy. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration, and promotes cancer cell invasion. Activates several signaling pathways in response to ligand binding. Phosphorylates PIK3R1, PLCG2, GRB2, SLA2 and CBL. Activation of PLCG2 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate, that then lead to the activation of protein kinase C family members, especially PRKCD. Phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, leads to activation of the AKT1 signaling pathway. Activated CSF1R also mediates activation of the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1, and of the SRC family kinases SRC, FYN and YES1. Activated CSF1R transmits signals both via proteins that directly interact with phosphorylated tyrosine residues in its intracellular domain, or via adapter proteins, such as GRB2. Promotes activation of STAT family members STAT3, STAT5A and/or STAT5B. Promotes tyrosine phosphorylation of SHC1 and INPP5D/SHIP-1. Receptor signaling is down-regulated by protein phosphatases, such as INPP5D/SHIP-1, that dephosphorylate the receptor and its downstream effectors, and by rapid internalization of the activated receptor.
Pfam Domain Function
Transmembrane Regions
518-538
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010602|Macrophage colony-stimulating factor 1 receptor (CSF1R)
ATGGGCCCAGGAGTTCTGCTGCTCCTGCTGGTGGCCACAGCTTGGCATGGTCAGGGAATC
CCAGTGATAGAGCCCAGTGTCCCTGAGCTGGTCGTGAAGCCAGGAGCAACGGTGACCTTG
CGATGTGTGGGCAATGGCAGCGTGGAATGGGATGGCCCCCCATCACCTCACTGGACCCTG
TACTCTGATGGCTCCAGCAGCATCCTCAGCACCAACAACGCTACCTTCCAAAACACGGGG
ACCTATCGCTGCACTGAGCCTGGAGACCCCCTGGGAGGCAGCGCCGCCATCCACCTCTAT
GTCAAAGACCCTGCCCGGCCCTGGAACGTGCTAGCACAGGAGGTGGTCGTGTTCGAGGAC
CAGGACGCACTACTGCCCTGTCTGCTCACAGACCCGGTGCTGGAAGCAGGCGTCTCGCTG
GTGCGTGTGCGTGGCCGGCCCCTCATGCGCCACACCAACTACTCCTTCTCGCCCTGGCAT
GGCTTCACCATCCACAGGGCCAAGTTCATTCAGAGCCAGGACTATCAATGCAGTGCCCTG
ATGGGTGGCAGGAAGGTGATGTCCATCAGCATCCGGCTGAAAGTGCAGAAAGTCATCCCA
GGGCCCCCAGCCTTGACACTGGTGCCTGCAGAGCTGGTGCGGATTCGAGGGGAGGCTGCC
CAGATCGTGTGCTCAGCCAGCAGCGTTGATGTTAACTTTGATGTCTTCCTCCAACACAAC
AACACCAAGCTCGCAATCCCTCAACAATCTGACTTTCATAATAACCGTTACCAAAAAGTC
CTGACCCTCAACCTCGATCAAGTAGATTTCCAACATGCCGGCAACTACTCCTGCGTGGCC
AGCAACGTGCAGGGCAAGCACTCCACCTCCATGTTCTTCCGGGTGGTAGAGAGTGCCTAC
TTGAACTTGAGCTCTGAGCAGAACCTCATCCAGGAGGTGACCGTGGGGGAGGGGCTCAAC
CTCAAAGTCATGGTGGAGGCCTACCCAGGCCTGCAAGGTTTTAACTGGACCTACCTGGGA
CCCTTTTCTGACCACCAGCCTGAGCCCAAGCTTGCTAATGCTACCACCAAGGACACATAC
AGGCACACCTTCACCCTCTCTCTGCCCCGCCTGAAGCCCTCTGAGGCTGGCCGCTACTCC
TTCCTGGCCAGAAACCCAGGAGGCTGGAGAGCTCTGACGTTTGAGCTCACCCTTCGATAC
CCCCCAGAGGTAAGCGTCATATGGACATTCATCAACGGCTCTGGCACCCTTTTGTGTGCT
GCCTCTGGGTACCCCCAGCCCAACGTGACATGGCTGCAGTGCAGTGGCCACACTGATAGG
TGTGATGAGGCCCAAGTGCTGCAGGTCTGGGATGACCCATACCCTGAGGTCCTGAGCCAG
GAGCCCTTCCACAAGGTGACGGTGCAGAGCCTGCTGACTGTTGAGACCTTAGAGCACAAC
CAAACCTACGAGTGCAGGGCCCACAACAGCGTGGGGAGTGGCTCCTGGGCCTTCATACCC
ATCTCTGCAGGAGCCCACACGCATCCCCCGGATGAGTTCCTCTTCACACCAGTGGTGGTC
GCCTGCATGTCCATCATGGCCTTGCTGCTGCTGCTGCTCCTGCTGCTATTGTACAAGTAT
AAGCAGAAGCCCAAGTACCAGGTCCGCTGGAAGATCATCGAGAGCTATGAGGGCAACAGT
TATACTTTCATCGACCCCACGCAGCTGCCTTACAACGAGAAGTGGGAGTTCCCCCGGAAC
AACCTGCAGTTTGGTAAGACCCTCGGAGCTGGAGCCTTTGGGAAGGTGGTGGAGGCCACG
GCCTTTGGTCTGGGCAAGGAGGATGCTGTCCTGAAGGTGGCTGTGAAGATGCTGAAGTCC
ACGGCCCATGCTGATGAGAAGGAGGCCCTCATGTCCGAGCTGAAGATCATGAGCCACCTG
GGCCAGCACGAGAACATCGTCAACCTTCTGGGAGCCTGTACCCATGGAGGCCCTGTACTG
GTCATCACGGAGTACTGTTGCTATGGCGACCTGCTCAACTTTCTGCGAAGGAAGGCTGAG
GCCATGCTGGGACCCAGCCTGAGCCCCGGCCAGGACCCCGAGGGAGGCGTCGACTATAAG
AACATCCACCTCGAGAAGAAATATGTCCGCAGGGACAGTGGCTTCTCCAGCCAGGGTGTG
GACACCTATGTGGAGATGAGGCCTGTCTCCACTTCTTCAAATGACTCCTTCTCTGAGCAA
GACCTGGACAAGGAGGATGGACGGCCCCTGGAGCTCCGGGACCTGCTTCACTTCTCCAGC
CAAGTAGCCCAGGGCATGGCCTTCCTCGCTTCCAAGAATTGCATCCACCGGGACGTGGCA
GCGCGTAACGTGCTGTTGACCAATGGTCATGTGGCCAAGATTGGGGACTTCGGGCTGGCT
AGGGACATCATGAATGACTCCAACTACATTGTCAAGGGCAATGCCCGCCTGCCTGTGAAG
TGGATGGCCCCAGAGAGCATCTTTGACTGTGTCTACACGGTTCAGAGCGACGTCTGGTCC
TATGGCATCCTCCTCTGGGAGATCTTCTCACTTGGGCTGAATCCCTACCCTGGCATCCTG
GTGAACAGCAAGTTCTATAAACTGGTGAAGGATGGATACCAAATGGCCCAGCCTGCATTT
GCCCCAAAGAATATATACAGCATCATGCAGGCCTGCTGGGCCTTGGAGCCCACCCACAGA
CCCACCTTCCAGCAGATCTGCTCCTTCCTTCAGGAGCAGGCCCAAGAGGACAGGAGAGAG
CGGGACTATACCAATCTGCCGAGCAGCAGCAGAAGCGGTGGCAGCGGCAGCAGCAGCAGT
GAGCTGGAGGAGGAGAGCTCTAGTGAGCACCTGACCTGCTGCGAGCAAGGGGATATCGCC
CAGCCCTTGCTGCAGCCCAACAACTATCAGTTCTGCTGA
Chromosome Location
5
Locus
5q33-q35
External Identifiers
ResourceLink
UniProtKB IDP07333
UniProtKB Entry NameCSF1R_HUMAN
GenBank Protein ID553224
GenBank Gene IDM25786
GenAtlas IDCSF1R
HGNC IDHGNC:2433
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01268Sunitinibapproved, investigationalyesinhibitorDetails
DB00619ImatinibapprovedunknownantagonistDetails
DB06080ABT-869investigationalunknownDetails
DB071675-CYANO-FURAN-2-CARBOXYLIC ACID [5-HYDROXYMETHYL-2-(4-METHYL-PIPERIDIN-1-YL)-PHENYL]-AMIDEexperimentalunknownDetails
DB072026-CHLORO-3-(3-METHYLISOXAZOL-5-YL)-4-PHENYLQUINOLIN-2(1H)-ONEexperimentalunknownDetails