Carbonic anhydrase 3

Details

Name
Carbonic anhydrase 3
Synonyms
  • 4.2.1.1
  • CA-III
  • Carbonate dehydratase III
  • Carbonic anhydrase III
Gene Name
CA3
Organism
Human
Amino acid sequence
>lcl|BSEQ0012519|Carbonic anhydrase 3
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDP
SCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPL
VSNWRPPQPINNRVVRASFK
Number of residues
260
Molecular Weight
29557.215
Theoretical pI
7.38
GO Classification
Functions
zinc ion binding / carbonate dehydratase activity / nickel cation binding / phosphatase activity
Processes
response to oxidative stress / small molecule metabolic process / response to ethanol / bicarbonate transport / one-carbon metabolic process
Components
cytosol
General Function
Zinc ion binding
Specific Function
Reversible hydration of carbon dioxide.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0012520|Carbonic anhydrase 3 (CA3)
ATGGCCAAGGAGTGGGGCTACGCCAGTCACAACGGTCCTGACCACTGGCATGAACTTTTC
CCAAATGCCAAGGGGGAAAACCAGTCGCCCGTTGAGCTGCATACTAAAGACATCAGGCAT
GACCCTTCTCTGCAGCCATGGTCTGTGTCTTATGATGGTGGCTCTGCCAAGACCATCCTG
AATAATGGGAAGACCTGCCGAGTTGTATTTGATGATACTTATGATAGGTCAATGCTGAGA
GGGGGTCCTCTCCCTGGACCCTACCGACTTCGCCAGTTTCATCTTCACTGGGGCTCTTCG
GATGATCATGGCTCTGAGCACACCGTGGATGGAGTCAAGTATGCAGCGGAGCTTCATTTG
GTTCACTGGAACCCGAAGTATAACACTTTTAAAGAAGCCCTGAAGCAGCGCGATGGGATC
GCTGTGATTGGCATTTTTCTGAAGATAGGACATGAGAATGGCGAGTTCCAGATTTTCCTT
GATGCATTGGACAAGATTAAGACAAAGGGCAAGGAGGCGCCCTTCACAAAGTTTGACCCA
TCCTGCCTGTTCCCGGCATGCCGGGACTACTGGACCTACCAGGGCTCATTCACCACGCCG
CCCTGCGAGGAATGCATTGTGTGGCTGCTGCTGAAGGAGCCCATGACCGTGAGCTCTGAC
CAGATGGCCAAGCTGCGGAGCCTCCTCTCCAGTGCTGAGAACGAGCCCCCAGTGCCTCTT
GTGAGCAACTGGCGACCTCCACAGCCTATCAATAACAGGGTGGTGAGAGCTTCCTTCAAA
TGA
Chromosome Location
8
Locus
8q13-q22
External Identifiers
ResourceLink
UniProtKB IDP07451
UniProtKB Entry NameCAH3_HUMAN
GenBank Protein ID189053812
GenBank Gene IDAK313254
HGNC IDHGNC:1374
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00909Zonisamideapproved, investigationalunknowninhibitorDetails
DB00819Acetazolamideapproved, vet_approvedyesinhibitorDetails
DB08846Ellagic AcidinvestigationalunknowninhibitorDetails
DB01194BrinzolamideapprovedunknowninhibitorDetails
DB00482Celecoxibapproved, investigationalunknowninhibitorDetails
DB01144Diclofenamideapproved, investigationalunknowninhibitorDetails
DB00869DorzolamideapprovedunknowninhibitorDetails
DB00311EthoxzolamidewithdrawnunknowninhibitorDetails
DB00703MethazolamideapprovedunknowninhibitorDetails
DB12418SaccharininvestigationalunknowninhibitorDetails
DB00391Sulpirideapproved, investigationalunknowninhibitorDetails
DB00273TopiramateapprovedunknowninhibitorDetails
DB00580Valdecoxibapproved, investigational, withdrawnunknowninhibitorDetails