Multidrug resistance protein 1

Details

Name
Multidrug resistance protein 1
Synonyms
  • 3.6.3.44
  • ATP-binding cassette sub-family B member 1
  • MDR1
  • P-glycoprotein 1
  • PGY1
Gene Name
ABCB1
Organism
Human
Amino acid sequence
>lcl|BSEQ0037114|Multidrug resistance protein 1
MDLEGDRNGGAKKKNFFKLNNKSEKDKKEKKPTVSVFSMFRYSNWLDKLYMVVGTLAAII
HGAGLPLMMLVFGEMTDIFANAGNLEDLMSNITNRSDINDTGFFMNLEEDMTRYAYYYSG
IGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDDVS
KINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFT
DKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIG
AAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASPSIEAFANARG
AAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSG
QTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLF
ATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIA
IARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAG
FDDGVIVEKGNHDELMKEKGIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRS
SLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPYFVVGVFCAII
NGGLQPAFAIIFSKIIGVFTRIDDPETKRQNSNLFSLLFLALGIISFITFFLQGFTFGKA
GEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNI
ANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEA
IENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFG
AYLVAHKLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDS
YSTEGLMPNTLEGNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVV
QLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVV
SQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHILLLD
EATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQL
LAQKGIYFSMVSVQAGTKRQ
Number of residues
1280
Molecular Weight
141477.255
Theoretical pI
9.44
GO Classification
Functions
transporter activity / ATP binding / xenobiotic-transporting ATPase activity / ATPase activity, coupled to transmembrane movement of substances
Processes
transmembrane transport / transport / drug transmembrane transport / G2/M transition of mitotic cell cycle / response to drug / stem cell proliferation / small molecule metabolic process
Components
membrane / plasma membrane / cell surface / integral component of membrane / extracellular exosome
General Function
Xenobiotic-transporting atpase activity
Specific Function
Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.
Pfam Domain Function
Transmembrane Regions
45-67 117-137 187-208 216-236 293-316 331-352 712-732 757-777 833-853 855-874 935-957 974-995
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0016291|Multidrug resistance protein 1 (ABCB1)
ATGGATCTTGAAGGGGACCGCAATGGAGGAGCAAAGAAGAAGAACTTTTTTAAACTGAAC
AATAAAAGTGAAAAAGATAAGAAGGAAAAGAAACCAACTGTCAGTGTATTTTCAATGTTT
CGCTATTCAAATTGGCTTGACAAGTTGTATATGGTGGTGGGAACTTTGGCTGCCATCATC
CATGGGGCTGGACTTCCTCTCATGATGCTGGTGTTTGGAGAAATGACAGATATCTTTGCA
AATGCAGGAAATTTAGAAGATCTGATGTCAAACATCACTAATAGAAGTGATATCAATGAT
ACAGGGTTCTTCATGAATCTGGAGGAAGACATGACCAGGTATGCCTATTATTACAGTGGA
ATTGGTGCTGGGGTGCTGGTTGCTGCTTACATTCAGGTTTCATTTTGGTGCCTGGCAGCT
GGAAGACAAATACACAAAATTAGAAAACAGTTTTTTCATGCTATAATGCGACAGGAGATA
GGCTGGTTTGATGTGCACGATGTTGGGGAGCTTAACACCCGACTTACAGATGATGTCTCC
AAGATTAATGAAGGAATTGGTGACAAAATTGGAATGTTCTTTCAGTCAATGGCAACATTT
TTCACTGGGTTTATAGTAGGATTTACACGTGGTTGGAAGCTAACCCTTGTGATTTTGGCC
ATCAGTCCTGTTCTTGGACTGTCAGCTGCTGTCTGGGCAAAGATACTATCTTCATTTACT
GATAAAGAACTCTTAGCGTATGCAAAAGCTGGAGCAGTAGCTGAAGAGGTCTTGGCAGCA
ATTAGAACTGTGATTGCATTTGGAGGACAAAAGAAAGAACTTGAAAGGTACAACAAAAAT
TTAGAAGAAGCTAAAAGAATTGGGATAAAGAAAGCTATTACAGCCAATATTTCTATAGGT
GCTGCTTTCCTGCTGATCTATGCATCTTATGCTCTGGCCTTCTGGTATGGGACCACCTTG
GTCCTCTCAGGGGAATATTCTATTGGACAAGTACTCACTGTATTCTTTTCTGTATTAATT
GGGGCTTTTAGTGTTGGACAGGCATCTCCAAGCATTGAAGCATTTGCAAATGCAAGAGGA
GCAGCTTATGAAATCTTCAAGATAATTGATAATAAGCCAAGTATTGACAGCTATTCGAAG
AGTGGGCACAAACCAGATAATATTAAGGGAAATTTGGAATTCAGAAATGTTCACTTCAGT
TACCCATCTCGAAAAGAAGTTAAGATCTTGAAGGGTCTGAACCTGAAGGTGCAGAGTGGG
CAGACGGTGGCCCTGGTTGGAAACAGTGGCTGTGGGAAGAGCACAACAGTCCAGCTGATG
CAGAGGCTCTATGACCCCACAGAGGGGATGGTCAGTGTTGATGGACAGGATATTAGGACC
ATAAATGTAAGGTTTCTACGGGAAATCATTGGTGTGGTGAGTCAGGAACCTGTATTGTTT
GCCACCACGATAGCTGAAAACATTCGCTATGGCCGTGAAAATGTCACCATGGATGAGATT
GAGAAAGCTGTCAAGGAAGCCAATGCCTATGACTTTATCATGAAACTGCCTCATAAATTT
GACACCCTGGTTGGAGAGAGAGGGGCCCAGTTGAGTGGTGGGCAGAAGCAGAGGATCGCC
ATTGCACGTGCCCTGGTTCGCAACCCCAAGATCCTCCTGCTGGATGAGGCCACGTCAGCC
TTGGACACAGAAAGCGAAGCAGTGGTTCAGGTGGCTCTGGATAAGGCCAGAAAAGGTCGG
ACCACCATTGTGATAGCTCATCGTTTGTCTACAGTTCGTAATGCTGACGTCATCGCTGGT
TTCGATGATGGAGTCATTGTGGAGAAAGGAAATCATGATGAACTCATGAAAGAGAAAGGC
ATTTACTTCAAACTTGTCACAATGCAGACAGCAGGAAATGAAGTTGAATTAGAAAATGCA
GCTGATGAATCCAAAAGTGAAATTGATGCCTTGGAAATGTCTTCAAATGATTCAAGATCC
AGTCTAATAAGAAAAAGATCAACTCGTAGGAGTGTCCGTGGATCACAAGCCCAAGACAGA
AAGCTTAGTACCAAAGAGGCTCTGGATGAAAGTATACCTCCAGTTTCCTTTTGGAGGATT
ATGAAGCTAAATTTAACTGAATGGCCTTATTTTGTTGTTGGTGTATTTTGTGCCATTATA
AATGGAGGCCTGCAACCAGCATTTGCAATAATATTTTCAAAGATTATAGGGGTTTTTACA
AGAATTGATGATCCTGAAACAAAACGACAGAATAGTAACTTGTTTTCACTATTGTTTCTA
GCCCTTGGAATTATTTCTTTTATTACATTTTTCCTTCAGGGTTTCACATTTGGCAAAGCT
GGAGAGATCCTCACCAAGCGGCTCCGATACATGGTTTTCCGATCCATGCTCAGACAGGAT
GTGAGTTGGTTTGATGACCCTAAAAACACCACTGGAGCATTGACTACCAGGCTCGCCAAT
GATGCTGCTCAAGTTAAAGGGGCTATAGGTTCCAGGCTTGCTGTAATTACCCAGAATATA
GCAAATCTTGGGACAGGAATAATTATATCCTTCATCTATGGTTGGCAACTAACACTGTTA
CTCTTAGCAATTGTACCCATCATTGCAATAGCAGGAGTTGTTGAAATGAAAATGTTGTCT
GGACAAGCACTGAAAGATAAGAAAGAACTAGAAGGTTCTGGGAAGATCGCTACTGAAGCA
ATAGAAAACTTCCGAACCGTTGTTTCTTTGACTCAGGAGCAGAAGTTTGAACATATGTAT
GCTCAGAGTTTGCAGGTACCATACAGAAACTCTTTGAGGAAAGCACACATCTTTGGAATT
ACATTTTCCTTCACCCAGGCAATGATGTATTTTTCCTATGCTGGATGTTTCCGGTTTGGA
GCCTACTTGGTGGCACATAAACTCATGAGCTTTGAGGATGTTCTGTTAGTATTTTCAGCT
GTTGTCTTTGGTGCCATGGCCGTGGGGCAAGTCAGTTCATTTGCTCCTGACTATGCCAAA
GCCAAAATATCAGCAGCCCACATCATCATGATCATTGAAAAAACCCCTTTGATTGACAGC
TACAGCACGGAAGGCCTAATGCCGAACACATTGGAAGGAAATGTCACATTTGGTGAAGTT
GTATTCAACTATCCCACCCGACCGGACATCCCAGTGCTTCAGGGACTGAGCCTGGAGGTG
AAGAAGGGCCAGACGCTGGCTCTGGTGGGCAGCAGTGGCTGTGGGAAGAGCACAGTGGTC
CAGCTCCTGGAGCGGTTCTACGACCCCTTGGCAGGGAAAGTGCTGCTTGATGGCAAAGAA
ATAAAGCGACTGAATGTTCAGTGGCTCCGAGCACACCTGGGCATCGTGTCCCAGGAGCCC
ATCCTGTTTGACTGCAGCATTGCTGAGAACATTGCCTATGGAGACAACAGCCGGGTGGTG
TCACAGGAAGAGATTGTGAGGGCAGCAAAGGAGGCCAACATACATGCCTTCATCGAGTCA
CTGCCTAATAAATATAGCACTAAAGTAGGAGACAAAGGAACTCAGCTCTCTGGTGGCCAG
AAACAACGCATTGCCATAGCTCGTGCCCTTGTTAGACAGCCTCATATTTTGCTTTTGGAT
GAAGCCACGTCAGCTCTGGATACAGAAAGTGAAAAGGTTGTCCAAGAAGCCCTGGACAAA
GCCAGAGAAGGCCGCACCTGCATTGTGATTGCTCACCGCCTGTCCACCATCCAGAATGCA
GACTTAATAGTGGTGTTTCAGAATGGCAGAGTCAAGGAGCATGGCACGCATCAGCAGCTG
CTGGCACAGAAAGGCATCTATTTTTCAATGGTCAGTGTCCAGGCTGGAACAAAGCGCCAG
TGA
Chromosome Location
7
Locus
7q21.1
External Identifiers
ResourceLink
UniProtKB IDP08183
UniProtKB Entry NameMDR1_HUMAN
GenBank Protein ID307180
GenBank Gene IDM14758
GenAtlas IDABCB1
HGNC IDHGNC:40
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00171ATPinvestigational, nutraceuticalunknownDetails
DB00778Roxithromycinapproved, investigational, withdrawnunknownDetails
DB04881ElacridarinvestigationalunknownDetails
DB04905TesmilifeneinvestigationalyesinducerDetails
DB05449FM-VP4investigationalunknownDetails
DB06240TariquidarinvestigationalunknownDetails
DB06191ZosuquidarinvestigationalunknownDetails
DB00661VerapamilapprovedunknownsubstrateinhibitorinducerDetails
DB01232Saquinavirapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB00220NelfinavirapprovedunknownsubstrateinhibitorinducerDetails
DB00224IndinavirapprovedunknownsubstrateinhibitorinducerDetails
DB00701Amprenavirapproved, investigationalunknowninhibitorinducerDetails
DB01045RifampicinapprovedunknownsubstrateinhibitorinducerDetails
DB00206Reserpineapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB01115NifedipineapprovedunknownsubstrateinhibitorinducerDetails
DB00834Mifepristoneapproved, investigationalunknowninhibitorinducerDetails
DB01234Dexamethasoneapproved, investigational, vet_approvedunknownsubstrateinhibitorinducerDetails
DB00257Clotrimazoleapproved, vet_approvedunknowninhibitorinducerDetails
DB00564Carbamazepineapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB00656Trazodoneapproved, investigationalunknowninducerDetails
DB01149Nefazodoneapproved, withdrawnunknowninducerDetails
DB00503Ritonavirapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB00390DigoxinapprovedunknownsubstrateinhibitorinducerDetails
DB00279Liothyronineapproved, vet_approvedunknowninducerDetails
DB00451LevothyroxineapprovedunknowninducerDetails
DB00440Trimethoprimapproved, vet_approvedunknowninhibitorinducerDetails
DB00396Progesteroneapproved, vet_approvedunknownsubstrateinhibitorinducerDetails
DB02261Platelet Activating FactorexperimentalunknowninducerDetails
DB00091Cyclosporineapproved, investigational, vet_approvedunknownsubstrateinhibitorinducerDetails
DB00501Cimetidineapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB04630Aldosteroneexperimental, investigationalunknownsubstrateinducerDetails
DB00864Tacrolimusapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB00877Sirolimusapproved, investigationalunknowninhibitorinducerDetails
DB01174Phenobarbitalapproved, investigationalunknownsubstrateinducerDetails
DB00683Midazolamapproved, illicitunknownsubstrateinhibitorinducerDetails
DB00199Erythromycinapproved, investigational, vet_approvednoinhibitorDetails
DB01118Amiodaroneapproved, investigationalunknowninhibitorinducerDetails
DB01323St. John's Wortapproved, investigational, nutraceuticalunknowninducerDetails
DB00541Vincristineapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB00570VinblastineapprovedunknownsubstrateinhibitorinducerDetails
DB02659Cholic AcidapprovedunknowninducerDetails
DB00675TamoxifenapprovedunknownsubstrateinhibitorinducerDetails
DB00428Streptozocinapproved, investigationalunknowninducerDetails
DB01204Mitoxantroneapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB00997Doxorubicinapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB00694DaunorubicinapprovedunknownsubstrateinhibitorinducerDetails
DB00908Quinidineapproved, investigationalunknownsubstrateinhibitorDetails
DB01026Ketoconazoleapproved, investigationalunknownsubstrateinhibitorDetails
DB01388Mibefradilinvestigational, withdrawnunknowninhibitorDetails
DB04540Cholesterolapproved, experimental, investigationalunknowninhibitorDetails
DB00358Mefloquineapproved, investigationalunknowninhibitorDetails
DB00622Nicardipineapproved, investigationalunknownsubstrateinhibitorDetails
DB00381AmlodipineapprovedunknowninhibitorDetails
DB00624Testosteroneapproved, investigationalunknowninhibitorDetails
DB00972AzelastineapprovedunknowninhibitorDetails
DB00863RanitidineapprovedunknownsubstrateinhibitorDetails
DB01032Probenecidapproved, investigationalunknowninhibitorDetails
DB00773EtoposideapprovedunknownsubstrateinhibitorDetails
DB00333MethadoneapprovedunknowninhibitorDetails
DB00641SimvastatinapprovedunknowninhibitorDetails
DB00227Lovastatinapproved, investigationalunknowninhibitorDetails
DB01076AtorvastatinapprovedunknowninhibitorDetails
DB00361Vinorelbineapproved, investigationalunknowninhibitorDetails
DB01229Paclitaxelapproved, vet_approvedunknownsubstrateinhibitorDetails
DB00457PrazosinapprovedunknownsubstrateinhibitorDetails
DB01054Nitrendipineapproved, investigationalunknowninhibitorDetails
DB01400Neostigmineapproved, vet_approvedunknowninhibitorDetails
DB00643Mebendazoleapproved, vet_approvedunknowninhibitorDetails
DB00975DipyridamoleapprovedunknownsubstrateinhibitorDetails
DB00343Diltiazemapproved, investigationalunknownsubstrateinhibitorDetails
DB01394ColchicineapprovedunknownsubstrateinhibitorDetails
DB01211ClarithromycinapprovedunknownsubstrateinhibitorDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB00608Chloroquineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00970Dactinomycinapproved, investigationalunknownsubstrateinhibitorDetails
DB13179TroleandomycinapprovedunknowninhibitorDetails
DB00831Trifluoperazineapproved, investigationalunknowninhibitorDetails
DB00342Terfenadineapproved, withdrawnunknowninhibitorDetails
DB00468QuinineapprovedunknownsubstrateinhibitorDetails
DB01167Itraconazoleapproved, investigationalunknowninhibitorDetails
DB00328Indomethacinapproved, investigationalunknownsubstrateinhibitorDetails
DB02587Colforsinexperimental, investigationalunknowninhibitorDetails
DB00623FluphenazineapprovedunknowninhibitorDetails
DB01023Felodipineapproved, investigationalunknowninhibitorDetails
DB00845Clofazimineapproved, investigationalunknowninhibitorDetails
DB01136Carvedilolapproved, investigationalunknowninhibitorDetails
DB00421SpironolactoneapprovedunknowninhibitorDetails
DB04417P-NitrophenolexperimentalunknowninhibitorDetails
DB00281Lidocaineapproved, vet_approvedunknowninhibitorDetails
DB00586Diclofenacapproved, vet_approvedunknowninhibitorDetails
DB00514DextromethorphanapprovedunknowninhibitorDetails
DB00531Cyclophosphamideapproved, investigationalunknowninhibitorDetails
DB00537Ciprofloxacinapproved, investigationalunknownsubstrateinhibitorDetails
DB00207AzithromycinapprovedunknowninhibitorDetails
DB00316AcetaminophenapprovedunknownsubstrateinhibitorDetails
DB00196Fluconazoleapproved, investigationalunknowninhibitorDetails
DB00213PantoprazoleapprovedunknowninhibitorDetails
DB00338Omeprazoleapproved, investigational, vet_approvedunknowninhibitorDetails
DB00448Lansoprazoleapproved, investigationalunknownsubstrateinhibitorDetails
DB00790PerindoprilapprovedunknowninhibitorDetails
DB00264Metoprololapproved, investigationalunknownsubstrateinhibitorDetails
DB00678LosartanapprovedunknownsubstrateinhibitorDetails
DB00584Enalaprilapproved, vet_approvedunknowninhibitorDetails
DB00590DoxazosinapprovedunknowninhibitorDetails
DB01340CilazaprilapprovedunknowninhibitorDetails
DB01197CaptoprilapprovedunknowninhibitorDetails
DB00796Candesartan cilexetilapprovedunknowninhibitorDetails
DB00335AtenololapprovedunknownsubstrateinhibitorDetails
DB00518Albendazoleapproved, vet_approvedunknowninhibitorDetails
DB01110Miconazoleapproved, investigational, vet_approvedunknowninhibitorDetails
DB00696ErgotamineapprovedunknowninhibitorDetails
DB01253ErgonovineapprovedunknowninhibitorDetails
DB00320Dihydroergotamineapproved, investigationalunknowninhibitorDetails
DB01200Bromocriptineapproved, investigationalunknownsubstrateinhibitorDetails
DB00836LoperamideapprovedunknownsubstrateinhibitorDetails
DB00813Fentanylapproved, illicit, investigational, vet_approvedunknowninhibitorDetails
DB00802Alfentanilapproved, illicitunknowninhibitorDetails
DB00401NisoldipineapprovedunknowninhibitorDetails
DB04832ZimelidinewithdrawnunknowninhibitorDetails
DB00382Tacrineinvestigational, withdrawnunknowninhibitorDetails
DB00669Sumatriptanapproved, investigationalunknowninhibitorDetails
DB01037Selegilineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00747Scopolamineapproved, investigationalunknowninhibitorDetails
DB01595NitrazepamapprovedunknowninhibitorDetails
DB00704Naltrexoneapproved, investigational, vet_approvedunknowninhibitorDetails
DB00371Meprobamateapproved, illicitunknowninhibitorDetails
DB00934Maprotilineapproved, investigationalunknowninhibitorDetails
DB01221Ketamineapproved, vet_approvedunknowninhibitorDetails
DB00458ImipramineapprovedunknownsubstrateinhibitorDetails
DB00502HaloperidolapprovedunknownsubstrateinhibitorDetails
DB00176Fluvoxamineapproved, investigationalunknowninhibitorDetails
DB00690Flurazepamapproved, illicit, investigationalunknowninhibitorDetails
DB00472Fluoxetineapproved, vet_approvedunknowninhibitorDetails
DB01142Doxepinapproved, investigationalunknowninhibitorDetails
DB01151Desipramineapproved, investigationalunknowninhibitorDetails
DB01242Clomipramineapproved, investigational, vet_approvedunknowninhibitorDetails
DB01239Chlorprothixeneapproved, investigational, withdrawnunknowninhibitorDetails
DB00490Buspironeapproved, investigationalunknowninhibitorDetails
DB00810Biperidenapproved, investigationalunknowninhibitorDetails
DB00321AmitriptylineapprovedunknownsubstrateinhibitorDetails
DB00915AmantadineapprovedunknowninhibitorDetails
DB01100PimozideapprovedunknowninhibitorDetails
DB00295Morphineapproved, investigationalunknownsubstrateinhibitorDetails
DB00602Ivermectinapproved, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB00741Hydrocortisoneapproved, vet_approvedunknownsubstrateinhibitorDetails
DB00637Astemizoleapproved, withdrawnunknowninhibitorDetails
DB00508Triflupromazineapproved, vet_approvedunknowninhibitorDetails
DB00344ProtriptylineapprovedunknowninhibitorDetails
DB01069Promethazineapproved, investigationalunknowninhibitorDetails
DB00672Chlorpropamideapproved, investigationalunknowninhibitorDetails
DB01244Bepridilapproved, withdrawnunknowninhibitorDetails
DB00455Loratadineapproved, investigationalunknowninhibitorDetails
DB00967Desloratadineapproved, investigationalunknowninhibitorDetails
DB00285VenlafaxineapprovedunknownsubstrateinhibitorDetails
DB01104SertralineapprovedunknowninhibitorDetails
DB00234Reboxetineapproved, investigationalunknowninhibitorDetails
DB00715Paroxetineapproved, investigationalunknowninhibitorDetails
DB00215CitalopramapprovedunknownsubstrateinhibitorDetails
DB01196Estramustineapproved, investigationalunknowninhibitorDetails
DB04348Taurocholic AcidexperimentalunknownsubstrateinhibitorDetails
DB00875Flupentixolapproved, investigational, withdrawnunknowninhibitorDetails
DB00351Megestrol acetateapproved, investigational, vet_approvedunknowninhibitorDetails
DB02010StaurosporineexperimentalunknowninhibitorDetails
DB01103Quinacrineapproved, investigationalunknowninhibitorDetails
DB01645GenisteininvestigationalunknowninhibitorDetails
DB04216Quercetinexperimental, investigationalunknowninhibitorDetails
DB00345Aminohippuric acidapproved, investigationalunknowninhibitorDetails
DB01137Levofloxacinapproved, investigationalunknownsubstrateinhibitorDetails
DB03467NaringeninexperimentalunknowninhibitorDetails
DB01016GlyburideapprovedunknowninhibitorDetails
DB00201CaffeineapprovedunknownsubstrateinhibitorDetails
DB00950Fexofenadineapproved, investigationalunknownsubstrateinhibitorDetails
DB01138SulfinpyrazoneapprovedunknowninhibitorDetails
DB03796Palmitic Acidapproved, experimentalunknowninhibitorDetails
DB09462Glycerinapproved, investigationalunknowninhibitorDetails
DB00726TrimipramineapprovedunknowninhibitorDetails
DB00571Propranololapproved, investigationalunknownsubstrateinhibitorDetails
DB00635Prednisoneapproved, vet_approvedunknownsubstrateinhibitorDetails
DB00276Amsacrineapproved, investigationalunknowninhibitorDetails
DB00305MitomycinapprovedunknowninhibitorDetails
DB00027Gramicidin DapprovedunknowninhibitorDetails
DB01086Benzocaineapproved, investigationalunknowninhibitorDetails
DB01601LopinavirapprovedunknowninhibitorDetails
DB00520CaspofunginapprovedunknowninhibitorDetails
DB00175PravastatinapprovedunknownsubstrateinhibitorDetails
DB00619ImatinibapprovedunknownsubstrateinhibitorDetails
DB00398Sorafenibapproved, investigationalunknownsubstrateinhibitorDetails
DB01268Sunitinibapproved, investigationalunknowninhibitorDetails
DB01162TerazosinapprovedunknowninhibitorDetails
DB00470Dronabinolapproved, illicitunknowninhibitorDetails
DB00921Buprenorphineapproved, illicit, investigational, vet_approvedunknowninhibitorDetails
DB00966Telmisartanapproved, investigationalunknowninhibitorDetails
DB01254Dasatinibapproved, investigationalunknownsubstrateinhibitorDetails
DB00317Gefitinibapproved, investigationalunknownsubstrateinhibitorDetails
DB04868Nilotinibapproved, investigationalunknownsubstrateinhibitorDetails
DB00655EstroneapprovedunknownsubstrateinducerDetails
DB01259Lapatinibapproved, investigationalunknowninhibitorDetails
DB01263Posaconazoleapproved, investigational, vet_approvedunknowninhibitorDetails
DB00365Grepafloxacinapproved, investigational, withdrawnunknownsubstrateinhibitorDetails
DB00829Diazepamapproved, illicit, investigational, vet_approvedunknownsubstrateDetails
DB01396Digitoxinapproved, investigationalunknownsubstrateDetails
DB01208Sparfloxacinapproved, investigationalunknownsubstrateDetails
DB00959Methylprednisoloneapproved, vet_approvedunknownsubstrateDetails
DB01224QuetiapineapprovedunknownsubstrateDetails
DB00334Olanzapineapproved, investigationalunknownsubstrateDetails
DB00363ClozapineapprovedunknownsubstrateDetails
DB01183Naloxoneapproved, vet_approvedunknownsubstrateDetails
DB00515CisplatinapprovedunknownsubstrateDetails
DB04690CamptothecinexperimentalunknownsubstrateDetails
DB00860Prednisoloneapproved, vet_approvedunknownsubstrateDetails
DB01193Acebutololapproved, investigationalunknownsubstrateDetails
DB01050IbuprofenapprovedunknownsubstrateDetails
DB00936Salicylic acidapproved, investigational, vet_approvedunknownsubstrateDetails
DB00945Acetylsalicylic acidapproved, vet_approvedunknownsubstrateDetails
DB00575ClonidineapprovedunknownsubstrateDetails
DB01184Domperidoneapproved, investigational, vet_approvedunknownsubstrateDetails
DB00742Mannitolapproved, investigationalunknownsubstrateDetails
DB00443Betamethasoneapproved, vet_approvedunknownsubstrateDetails
DB00539Toremifeneapproved, investigationalunknownsubstrateDetails
DB00255Diethylstilbestrolapproved, investigationalunknownsubstrateDetails
DB00882Clomifeneapproved, investigationalunknownsubstrateDetails
DB00783Estradiolapproved, investigational, vet_approvedunknownsubstrateDetails
DB01248Docetaxelapproved, investigationalunknownsubstrateDetails
DB00563MethotrexateapprovedunknownsubstrateDetails
DB00373TimololapprovedunknownsubstrateDetails
DB01203NadololapprovedunknownsubstrateDetails
DB00523Alitretinoinapproved, investigationalunknownsubstrateDetails
DB01339VecuroniumapprovedunknownsubstrateDetails
DB04840Debrisoquinapproved, investigationalunknownsubstrateDetails
DB00441GemcitabineapprovedunknownsubstrateDetails
DB01030Topotecanapproved, investigationalunknownsubstrateDetails
DB02901Stanoloneillicit, investigationalunknownsubstrateDetails
DB00751Epinastineapproved, investigationalunknownsubstrateDetails
DB00717NorethisteroneapprovedunknowninducerDetails
DB04573Estriolapproved, investigational, vet_approvedunknownsubstrateinducerDetails
DB03203SphingosineexperimentalunknownsubstrateDetails
DB00439Cerivastatinapproved, withdrawnunknownsubstrateDetails
DB00286Conjugated estrogensapprovedunknownsubstrateDetails
DB01202Levetiracetamapproved, investigationalunknownsubstrateDetails
DB00252Phenytoinapproved, vet_approvedunknownsubstrateDetails
DB00585NizatidineapprovedunknownsubstrateDetails
DB00530Erlotinibapproved, investigationalunknownsubstrateDetails
DB00555Lamotrigineapproved, investigationalunknownsubstrateDetails
DB01261Sitagliptinapproved, investigationalunknownsubstrateDetails
DB01072Atazanavirapproved, investigationalunknownsubstrateinhibitorDetails
DB01169Arsenic trioxideapproved, investigationalunknownsubstrateDetails
DB06772CabazitaxelapprovedunknownsubstrateinhibitorDetails
DB01583LiotrixapprovedunknowninducerDetails
DB06287TemsirolimusapprovedunknownsubstrateinhibitorDetails
DB01587KetazolamapprovedunknownsubstrateDetails
DB04877Voacamineapproved, investigationalunknownDetails
DB00977Ethinyl EstradiolapprovedunknownsubstrateDetails
DB01182PropafenoneapprovedunknowninhibitorDetails
DB00216Eletriptanapproved, investigationalunknownsubstrateDetails
DB04855DronedaroneapprovedunknowninhibitorDetails
DB06176Romidepsinapproved, investigationalunknownsubstrateDetails
DB06207SilodosinapprovedunknownsubstrateDetails
DB06414EtravirineapprovedunknowninhibitorDetails
DB06228RivaroxabanapprovedunknownsubstrateDetails
DB06695Dabigatran etexilateapprovedunknownsubstrateDetails
DB00973EzetimibeapprovedunknownsubstrateDetails
DB06702FesoterodineapprovedunknownsubstrateDetails
DB06212TolvaptanapprovednosubstrateinhibitorDetails
DB08860PitavastatinapprovedunknownsubstrateDetails
DB06589PazopanibapprovedunknownsubstrateDetails
DB08867UlipristalapprovednosubstrateDetails
DB08870Brentuximab vedotinapprovednosubstrateDetails
DB08864RilpivirineapprovedunknowninhibitorDetails
DB08873Boceprevirapproved, withdrawnunknowninhibitorDetails
DB05521Telaprevirapproved, withdrawnunknownsubstrateinhibitorDetails
DB08874FidaxomicinapprovedunknownsubstrateinhibitorDetails
DB05039IndacaterolapprovedunknownsubstrateDetails
DB00349Clobazamapproved, illicitunknownsubstrateDetails
DB08882LinagliptinapprovedunknownsubstrateDetails
DB08827Lomitapideapproved, investigationalnoinhibitorDetails
DB08816TicagrelorapprovedunknownsubstrateinhibitorDetails
DB08865CrizotinibapprovedunknownsubstrateinhibitorDetails
DB06605ApixabanapprovedunknownsubstrateDetails
DB06626Axitinibapproved, investigationalnosubstrateDetails
DB08828Vismodegibapproved, investigationalunknownsubstrateDetails
DB08889Carfilzomibapproved, investigationalunknownsubstrateDetails
DB08893MirabegronapprovedunknownsubstrateDetails
DB08896RegorafenibapprovedunknowninhibitorDetails
DB08899EnzalutamideapprovedunknowninhibitorDetails
DB08820IvacaftorapprovednoinhibitorDetails
DB06616BosutinibapprovedunknownsubstrateinhibitorDetails
DB08901Ponatinibapproved, investigationalunknownsubstrateinhibitorDetails
DB08906Fluticasone furoateapprovedunknownsubstrateDetails
DB08907CanagliflozinapprovedunknownsubstrateinhibitorDetails
DB08910PomalidomideapprovedunknownsubstrateDetails
DB00480LenalidomideapprovedunknownsubstrateDetails
DB08912Dabrafenibapproved, investigationalunknownsubstrateDetails
DB05773Trastuzumab emtansineapproved, investigationalunknownsubstrateDetails
DB00495ZidovudineapprovedunknownsubstrateDetails
DB00758ClopidogrelapprovedunknownsubstrateDetails
DB08916AfatinibapprovedunknownsubstrateinhibitorDetails
DB00762Irinotecanapproved, investigationalunknownsubstrateDetails
DB00709Lamivudineapproved, investigationalunknownsubstrateDetails
DB00688Mycophenolate mofetilapproved, investigationalunknownsubstrateDetails
DB08918Levomilnacipranapproved, investigationalunknownsubstrateDetails
DB06290SimeprevirapprovedunknownsubstrateinhibitorDetails
DB08934SofosbuvirapprovednosubstrateDetails
DB06292DapagliflozinapprovedunknownsubstrateDetails
DB09076UmeclidiniumapprovednosubstrateDetails
DB09075EdoxabanapprovednosubstrateDetails
DB09063CeritinibapprovednosubstrateDetails
DB09078Lenvatinibapproved, investigationalnosubstrateDetails
DB09079NintedanibapprovednosubstrateDetails
DB09054IdelalisibapprovednosubstrateinhibitorDetails
DB09065CobicistatapprovedyesinhibitorDetails
DB09291Rolapitantapproved, investigationalnoinhibitorDetails
DB09102Daclatasvirapproved, investigationalunknowninhibitorDetails
DB06636Isavuconazoniumapproved, investigationalyesinhibitorDetails
DB06603Panobinostatapproved, investigationalyessubstrateDetails
DB05239Cobimetinibapproved, investigationalunknownsubstrateDetails
DB09330OsimertinibapprovednosubstrateDetails
DB11362SelexipagapprovednosubstrateDetails
DB11363Alectinibapproved, investigationalnoinhibitorDetails
DB06403Ambrisentanapproved, investigationalunknownsubstrateDetails
DB09296Ombitasvirapproved, investigationalnosubstrateDetails
DB11574ElbasvirapprovednosubstrateDetails
DB11575GrazoprevirapprovednosubstrateDetails
DB09161Technetium Tc-99m sestamibiapproved, investigationalnosubstrateDetails
DB11581Venetoclaxapproved, investigationalnosubstrateDetails
DB09462Glycerinapproved, investigationalyesinhibitorDetails
DB05015Belinostatapproved, investigationalunknownsubstrateDetails
DB11613Velpatasvirapproved, investigationalnosubstrateinhibitorDetails
DB06670OdanacatibinvestigationalnosubstrateDetails
DB09027LedipasvirapprovednotransporterDetails
DB09198Lobeglitazoneapproved, investigationalnoDetails
DB09031Miltefosineapproved, investigationalunknownDetails
DB09280LumacaftorapprovednoinhibitorinducerDetails
DB12026Voxilaprevirapproved, investigationalnosubstrateinhibitorDetails
DB13874Enasidenibapproved, investigationalunknownsubstrateinhibitorDetails
DB05889Inotuzumab ozogamicinapproved, investigationalunknownsubstrateDetails
DB13878Pibrentasvirapproved, investigationalunknownsubstrateinhibitorDetails
DB13879Glecaprevirapproved, investigationalunknownsubstrateinhibitorDetails
DB12483Copanlisibapproved, investigationalunknownsubstrateDetails
DB12001Abemaciclibapproved, investigationalunknownsubstrateinhibitorDetails
DB12364Betrixabanapproved, investigationalnotransporterDetails
DB13919CandesartanexperimentalunknowninhibitorDetails
DB12070Letermovirapproved, investigationalnosubstrateinhibitorDetails
DB08930DolutegravirapprovednosubstrateDetails
DB12332Rucaparibapproved, investigationalunknownsubstrateinhibitorDetails
DB11817Baricitinibapproved, investigationalunknownsubstrateDetails
DB13146Fluciclovine (18F)approvednosubstrateDetails
DB09270Ubidecarenoneapproved, investigational, nutraceuticalnosubstrateDetails
DB11827Ertugliflozinapproved, investigationalnosubstrateDetails
DB13943Testosterone cypionateapprovedunknowninhibitorDetails
DB13944Testosterone enanthateapprovedunknowninhibitorDetails
DB13946Testosterone undecanoateapproved, investigationalunknowninhibitorDetails
DB09160Technetium Tc-99m tetrofosminapprovednobinderDetails
DB13951Stanolone acetateexperimentalunknownsubstrateDetails
DB13952Estradiol acetateapproved, investigational, vet_approvedunknownsubstrateDetails
DB13953Estradiol benzoateapproved, investigational, vet_approvedunknownsubstrateDetails
DB13954Estradiol cypionateapproved, investigational, vet_approvedunknownsubstrateDetails
DB13955Estradiol dienanthateapproved, investigational, vet_approvedunknownsubstrateDetails
DB13956Estradiol valerateapproved, investigational, vet_approvedunknownsubstrateDetails
DB01420Testosterone propionateapproved, investigational, vet_approved, withdrawnnosubstrateDetails
DB11901Apalutamideapproved, investigationalunknowninducerDetails