Beta-1 adrenergic receptor

Details

Name
Beta-1 adrenergic receptor
Synonyms
  • ADRB1R
  • B1AR
  • Beta-1 adrenoceptor
  • Beta-1 adrenoreceptor
Gene Name
ADRB1
Organism
Human
Amino acid sequence
>lcl|BSEQ0010188|Beta-1 adrenergic receptor
MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAP
LANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFV
FFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGP
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
Number of residues
477
Molecular Weight
51322.1
Theoretical pI
9.03
GO Classification
Functions
receptor signaling protein activity / beta-adrenergic receptor activity / alpha-2A adrenergic receptor binding / beta1-adrenergic receptor activity / epinephrine binding / norepinephrine binding / Ras guanyl-nucleotide exchange factor activity / protein heterodimerization activity / PDZ domain binding
Processes
diet induced thermogenesis / positive regulation of cAMP biosynthetic process / fear response / heat generation / temperature homeostasis / negative regulation of multicellular organism growth / positive regulation of cAMP-mediated signaling / positive regulation of heart rate by epinephrine-norepinephrine / cell-cell signaling / positive regulation of the force of heart contraction by epinephrine-norepinephrine / response to cold / activation of adenylate cyclase activity / vasodilation by norepinephrine-epinephrine involved in regulation of systemic arterial blood pressure / intracellular signal transduction / adenylate cyclase-activating adrenergic receptor signaling pathway / brown fat cell differentiation / positive regulation of GTPase activity
Components
plasma membrane / early endosome / integral component of plasma membrane
General Function
Receptor signaling protein activity
Specific Function
Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling.
Pfam Domain Function
Transmembrane Regions
56-84 94-120 133-154 173-196 223-248 320-349 355-377
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010189|Beta-1 adrenergic receptor (ADRB1)
ATGGGCGCGGGGGTGCTCGTCCTGGGCGCCTCCGAGCCCGGTAACCTGTCGTCGGCCGCA
CCGCTCCCCGACGGCGCGGCCACCGCGGCGCGGCTGCTGGTGCCCGCGTCGCCGCCCGCC
TCGTTGCTGCCTCCCGCCAGCGAAAGCCCCGAGCCGCTGTCTCAGCAGTGGACAGCGGGC
ATGGGTCTGCTGATGGCGCTCATCGTGCTGCTCATCGTGGCGGGCAATGTGCTGGTGATC
GTGGCCATCGCCAAGACGCCGCGGCTGCAGACGCTCACCAACCTCTTCATCATGTCCCTG
GCCAGCGCCGACCTGGTCATGGGGCTGCTGGTGGTGCCGTTCGGGGCCACCATCGTGGTG
TGGGGCCGCTGGGAGTACGGCTCCTTCTTCTGCGAGCTGTGGACCTCAGTGGACGTGCTG
TGCGTGACGGCCAGCATCGAGACCCTGTGTGTCATTGCCCTGGACCGCTACCTCGCCATC
ACCTCGCCCTTCCGCTACCAGAGCCTGCTGACGCGCGCGCGGGCGCGGGGCCTCGTGTGC
ACCGTGTGGGCCATCTCGGCCCTGGTGTCCTTCCTGCCCATCCTCATGCACTGGTGGCGG
GCGGAGAGCGACGAGGCGCGCCGCTGCTACAACGACCCCAAGTGCTGCGACTTCGTCACC
AACCGGGCCTACGCCATCGCCTCGTCCGTAGTCTCCTTCTACGTGCCCCTGTGCATCATG
GCCTTCGTGTACCTGCGGGTGTTCCGCGAGGCCCAGAAGCAGGTGAAGAAGATCGACAGC
TGCGAGCGCCGTTTCCTCGGCGGCCCAGCGCGGCCGCCCTCGCCCTCGCCCTCGCCCGTC
CCCGCGCCCGCGCCGCCGCCCGGACCCCCGCGCCCCGCCGCCGCCGCCGCCACCGCCCCG
CTGGCCAACGGGCGTGCGGGTAAGCGGCGGCCCTCGCGCCTCGTGGCCCTGCGCGAGCAG
AAGGCGCTCAAGACGCTGGGCATCATCATGGGCGTCTTCACGCTCTGCTGGCTGCCCTTC
TTCCTGGCCAACGTGGTGAAGGCCTTCCACCGCGAGCTGGTGCCCGACCGCCTCTTCGTC
TTCTTCAACTGGCTGGGCTACGCCAACTCGGCCTTCAACCCCATCATCTACTGCCGCAGC
CCCGACTTCCGCAAGGCCTTCCAGGGACTGCTCTGCTGCGCGCGCAGGGCTGCCCGCCGG
CGCCACGCGACCCACGGAGACCGGCCGCGCGCCTCGGGCTGTCTGGCCCGGCCCGGACCC
CCGCCATCGCCCGGGGCCGCCTCGGACGACGACGACGACGATGTCGTCGGGGCCACGCCG
CCCGCGCGCCTGCTGGAGCCCTGGGCCGGCTGCAACGGCGGGGCGGCGGCGGACAGCGAC
TCGAGCCTGGACGAGCCGTGCCGCCCCGGCTTCGCCTCGGAATCCAAGGTGTAG
Chromosome Location
10
Locus
10q24-q26
External Identifiers
ResourceLink
UniProtKB IDP08588
UniProtKB Entry NameADRB1_HUMAN
GenBank Protein ID178200
GenBank Gene IDJ03019
GenAtlas IDADRB1
HGNC IDHGNC:285
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00187EsmololapprovedyesantagonistDetails
DB00195Betaxololapproved, investigationalyesantagonistDetails
DB00221IsoetarineapprovedyesagonistDetails
DB00264Metoprololapproved, investigationalyesantagonistDetails
DB00335AtenololapprovedyesantagonistDetails
DB00373TimololapprovedyesantagonistDetails
DB00571Propranololapproved, investigationalyesantagonistDetails
DB00612BisoprololapprovedyesantagonistDetails
DB00841DobutamineapprovedyesagonistDetails
DB00866Alprenololapproved, withdrawnyesantagonistDetails
DB00960Pindololapproved, investigationalyespartial agonistDetails
DB01064Isoprenalineapproved, investigationalyesagonistDetails
DB01102ArbutamineapprovedyesagonistDetails
DB01193Acebutololapproved, investigationalyespartial agonistDetails
DB01203NadololapprovedyesantagonistDetails
DB01210LevobunololapprovedyesantagonistDetails
DB01214MetipranololapprovedyesantagonistDetails
DB00521Carteololapprovedyespartial agonistDetails
DB00598LabetalolapprovedyesantagonistDetails
DB00668Epinephrineapproved, vet_approvedyesagonistDetails
DB01118Amiodaroneapproved, investigationalyesantagonistDetails
DB01136Carvedilolapproved, investigationalyesantagonistDetails
DB01151Desipramineapproved, investigationalunknownotherDetails
DB01295BevantololapprovedyesantagonistDetails
DB01297PractololapprovedyesantagonistDetails
DB01580OxprenololapprovedyesantagonistDetails
DB01359Penbutololapproved, investigationalyesantagonistpartial agonistDetails
DB00368NorepinephrineapprovedyesagonistDetails
DB04855DronedaroneapprovedunknownDetails
DB04861Nebivololapproved, investigationalyesantagonistDetails
DB06262Droxidopaapproved, investigationalyesagonistDetails
DB01001Salbutamolapproved, vet_approvedunknownagonistDetails
DB00489SotalolapprovedyesantagonistDetails
DB01291PirbuterolapprovedunknownagonistDetails
DB01288Fenoterolapproved, investigationalunknownagonistDetails
DB00397Phenylpropanolamineapproved, vet_approved, withdrawnunknownagonistDetails
DB01407Clenbuterolapproved, investigational, vet_approvedunknownagonistDetails
DB083474-{[(2S)-3-(tert-butylamino)-2-hydroxypropyl]oxy}-3H-indole-2-carbonitrileexperimentalunknownDetails
DB085582-HYDROXYMETHYL-6-OCTYLSULFANYL-TETRAHYDRO-PYRAN-3,4,5-TRIOLexperimentalunknownDetails
DB08807Bopindololapprovedyespartial agonistDetails
DB08808BupranololapprovedyesantagonistDetails
DB00852Pseudoephedrineapprovedunknownagonistpartial agonistDetails
DB04846Celiprololapproved, investigationalyesantagonistDetails
DB01363Ephedraapproved, nutraceutical, withdrawnyesagonistDetails
DB06216AsenapineapprovedunknownantagonistDetails
DB00408LoxapineapprovedunknownbinderDetails
DB00370MirtazapineapprovedunknownbinderDetails
DB00248CabergolineapprovedunknownbinderDetails
DB09068Vortioxetineapproved, investigationalunknownligandDetails
DB09013BefunololexperimentalunknownDetails
DB00983Formoterolapproved, investigationalunknownagonistDetails
DB00938SalmeterolapprovedunknownagonistDetails
DB00871TerbutalineapprovedunknownantagonistDetails
DB01917PutrescineexperimentalunknownDetails
DB03566SpermidineexperimentalunknownDetails
DB00127Spermineapproved, nutraceuticalunknownDetails
DB01182PropafenoneapprovedunknownantagonistDetails
DB09351Levobetaxololapproved, investigationalyesantagonistDetails
DB13781Xamoterolexperimentalyespartial agonistDetails
DB09204ArotinololinvestigationalyesantagonistDetails
DB00555Lamotrigineapproved, investigationalunknowninhibitorDetails
DB11124RacepinephrineapprovedyesagonistDetails
DB11278DL-MethylephedrineapprovedyesagonistDetails
DB00182Amphetamineapproved, illicit, investigationalunknownagonistDetails
DB00540NortriptylineapprovedunknownantagonistDetails
DB00726TrimipramineapprovedunknownbinderDetails
DB00334Olanzapineapproved, investigationalunknowninhibitorDetails
DB00217BethanidineapprovedunknownantagonistDetails
DB00321AmitriptylineapprovedunknownbinderDetails
DB01365MephentermineapprovedunknownagonistDetails
DB06726Bufuralolexperimental, investigationalunknownantagonistDetails
DB13345Dihydroergocristineapproved, experimentalyesantagonistagonistDetails
DB01049Ergoloid mesylateapprovedyesantagonistagonistDetails
DB11273DihydroergocornineapprovedyesantagonistagonistDetails
DB11278DL-MethylephedrineapprovedyesagonistDetails