Cytochrome P450 3A4

Details

Name
Cytochrome P450 3A4
Synonyms
  • 1,8-cineole 2-exo-monooxygenase
  • 1.14.13.-
  • Albendazole monooxygenase
  • Albendazole sulfoxidase
  • Cholesterol 25-hydroxylase
  • CYP3A3
  • CYPIIIA3
  • CYPIIIA4
  • Cytochrome P450 3A3
  • Cytochrome P450 HLp
  • Cytochrome P450 NF-25
  • Cytochrome P450-PCN1
  • Nifedipine oxidase
  • Quinine 3-monooxygenase
  • Taurochenodeoxycholate 6-alpha-hydroxylase
Gene Name
CYP3A4
Organism
Human
Amino acid sequence
>lcl|BSEQ0021936|Cytochrome P450 3A4
MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMF
DMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI
AEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICV
FPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI
IFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVV
NETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFS
KKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLG
GLLQPEKPVVLKVESRDGTVSGA
Number of residues
503
Molecular Weight
57342.67
Theoretical pI
8.25
GO Classification
Functions
vitamin D3 25-hydroxylase activity / oxidoreductase activity / aromatase activity / albendazole monooxygenase activity / iron ion binding / caffeine oxidase activity / quinine 3-monooxygenase activity / heme binding / taurochenodeoxycholate 6alpha-hydroxylase activity / monooxygenase activity / steroid binding / oxygen binding / steroid hydroxylase activity / vitamin D 24-hydroxylase activity / enzyme binding / testosterone 6-beta-hydroxylase activity
Processes
steroid catabolic process / oxidation-reduction process / steroid metabolic process / drug catabolic process / lipid metabolic process / heterocycle metabolic process / xenobiotic metabolic process / monoterpenoid metabolic process / drug metabolic process / oxidative demethylation / androgen metabolic process / calcitriol biosynthetic process from calciol / vitamin D metabolic process / exogenous drug catabolic process / alkaloid catabolic process / small molecule metabolic process
Components
intracellular membrane-bounded organelle / cytoplasm / endoplasmic reticulum membrane / integral component of membrane
General Function
Vitamin d3 25-hydroxylase activity
Specific Function
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It performs a variety of oxidation reactions (e.g. caffeine 8-oxidation, omeprazole sulphoxidation, midazolam 1'-hydroxylation and midazolam 4-hydroxylation) of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Acts as a 1,8-cineole 2-exo-monooxygenase. The enzyme also hydroxylates etoposide (PubMed:11159812). Catalyzes 4-beta-hydroxylation of cholesterol. May catalyze 25-hydroxylation of cholesterol in vitro (PubMed:21576599).
Pfam Domain Function
Transmembrane Regions
2-22
Cellular Location
Endoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0021937|Cytochrome P450 3A4 (CYP3A4)
ATGGCTCTCATCCCAGACTTGGCCATGGAAACCTGGCTTCTCCTGGCTGTCAGCCTGGTG
CTCCTCTATCTATATGGAACCCATTCACATGGACTTTTTAAGAAGCTTGGAATTCCAGGG
CCCACACCTCTGCCTTTTTTGGGAAATATTTTGTCCTACCATAAGGGCTTTTGTATGTTT
GACATGGAATGTCATAAAAAGTATGGAAAAGTGTGGGGCTTTTATGATGGTCAACAGCCT
GTGCTGGCTATCACAGATCCTGACATGATCAAAACAGTGCTAGTGAAAGAATGTTATTCT
GTCTTCACAAACCGGAGGCCTTTTGGTCCAGTGGGATTTATGAAAAGTGCCATCTCTATA
GCTGAGGATGAAGAATGGAAGAGATTACGATCATTGCTGTCTCCAACCTTCACCAGTGGA
AAACTCAAGGAGATGGTCCCTATCATTGCCCAGTATGGAGATGTGTTGGTGAGAAATCTG
AGGCGGGAAGCAGAGACAGGCAAGCCTGTCACCTTGAAAGACGTCTTTGGGGCCTACAGC
ATGGATGTGATCACTAGCACATCATTTGGAGTGAACATCGACTCTCTCAACAATCCACAA
GACCCCTTTGTGGAAAACACCAAGAAGCTTTTAAGATTTGATTTTTTGGATCCATTCTTT
CTCTCAATAATCTTTCCATTCCTCATCCCAATTCTTGAAGTATTAAATATCTGTGTGTTT
CCAAGAGAAGTTACAAATTTTTTAAGAAAATCTGTAAAAAGGATGAAAGAAAGTCGCCTC
GAAGATACACAAAAGCACCGAGTGGATTTCCTTCAGCTGATGATTGACTCTCAGAATTCA
AAAGAAACTGAGTCCCACAAAGCTCTGTCCGATCTGGAGCTCGTGGCCCAATCAATTATC
TTTATTTTTGCTGGCTATGAAACCACGAGCAGTGTTCTCTCCTTCATTATGTATGAACTG
GCCACTCACCCTGATGTCCAGCAGAAACTGCAGGAGGAAATTGATGCAGTTTTACCCAAT
AAGGCACCACCCACCTATGATACTGTGCTACAGATGGAGTATCTTGACATGGTGGTGAAT
GAAACGCTCAGATTATTCCCAATTGCTATGAGACTTGAGAGGGTCTGCAAAAAAGATGTT
GAGATCAATGGGATGTTCATTCCCAAAGGGGTGGTGGTGATGATTCCAAGCTATGCTCTT
CACCGTGACCCAAAGTACTGGACAGAGCCTGAGAAGTTCCTCCCTGAAAGATTCAGCAAG
AAGAACAAGGACAACATAGATCCTTACATATACACACCCTTTGGAAGTGGACCCAGAAAC
TGCATTGGCATGAGGTTTGCTCTCATGAACATGAAACTTGCTCTAATCAGAGTCCTTCAG
AACTTCTCCTTCAAACCTTGTAAAGAAACACAGATCCCCCTGAAATTAAGCTTAGGAGGA
CTTCTTCAACCAGAAAAACCCGTTGTTCTAAAGGTTGAGTCAAGGGATGGCACCGTAAGT
GGAGCCTGA
Chromosome Location
7
Locus
7q21.1
External Identifiers
ResourceLink
UniProtKB IDP08684
UniProtKB Entry NameCP3A4_HUMAN
GenBank Gene IDM18907
GenAtlas IDCYP3A4
HGNC IDHGNC:2637
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB05478Pradefovir MesylateinvestigationalunknownDetails
DB00180Flunisolideapproved, investigationalunknownsubstrateinducerDetails
DB00185CevimelineapprovedunknownsubstrateDetails
DB00188Bortezomibapproved, investigationalnosubstrateinhibitorDetails
DB00196Fluconazoleapproved, investigationalunknowninhibitorDetails
DB00204Dofetilideapproved, investigationalunknownsubstrateDetails
DB00208TiclopidineapprovedunknownsubstrateDetails
DB00213PantoprazoleapprovedunknownsubstrateinducerDetails
DB00216Eletriptanapproved, investigationalunknownsubstrateinducerDetails
DB00220NelfinavirapprovedunknownsubstrateinhibitorDetails
DB00224IndinavirapprovedunknownsubstrateinhibitorDetails
DB00227Lovastatinapproved, investigationalunknownsubstrateinhibitorDetails
DB00234Reboxetineapproved, experimentalunknownsubstrateDetails
DB00238NevirapineapprovedunknownsubstrateinducerDetails
DB00243Ranolazineapproved, investigationalunknownsubstrateDetails
DB00246ZiprasidoneapprovedunknownsubstrateinhibitorDetails
DB00270Isradipineapproved, investigationalunknownsubstrateinhibitorDetails
DB00280DisopyramideapprovedunknownsubstrateDetails
DB00286Conjugated estrogensapprovednosubstrateDetails
DB00294Etonogestrelapproved, investigationalunknownsubstrateDetails
DB00297Bupivacaineapproved, investigationalunknownsubstrateDetails
DB00307Bexaroteneapproved, investigationalunknownsubstrateinducerDetails
DB00309Vindesineapproved, investigationalunknownsubstrateDetails
DB00317Gefitinibapproved, investigationalunknownsubstrateinhibitorDetails
DB00320Dihydroergotamineapproved, investigationalunknownsubstrateinhibitorDetails
DB00324Fluorometholoneapproved, investigationalunknownsubstrateDetails
DB00327Hydromorphoneapproved, illicitunknownsubstrateDetails
DB00332IpratropiumapprovedunknownsubstrateDetails
DB00342Terfenadineapproved, withdrawnunknownsubstrateinhibitorinducerDetails
DB00343Diltiazemapproved, investigationalunknownsubstrateinhibitorDetails
DB00346Alfuzosinapproved, investigationalunknownsubstrateDetails
DB00361Vinorelbineapproved, investigationalyessubstrateDetails
DB00365Grepafloxacinapproved, investigational, withdrawnunknownsubstrateDetails
DB00370MirtazapineapprovedunknownsubstrateinhibitorDetails
DB00381AmlodipineapprovedunknownsubstrateDetails
DB00393Nimodipineapproved, investigationalunknownsubstrateDetails
DB00398Sorafenibapproved, investigationalunknownsubstrateinhibitorDetails
DB00401NisoldipineapprovedunknownsubstrateDetails
DB00402Eszopicloneapproved, investigationalunknownsubstrateDetails
DB00404Alprazolamapproved, illicit, investigationalunknownsubstrateDetails
DB00425ZolpidemapprovedunknownsubstrateDetails
DB00433Prochlorperazineapproved, vet_approvedunknownsubstrateDetails
DB00443Betamethasoneapproved, vet_approvedunknownsubstrateinducerDetails
DB00455Loratadineapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB00468QuinineapprovedunknownsubstrateinhibitorinducerDetails
DB00470Dronabinolapproved, illicitunknownsubstrateDetails
DB00471MontelukastapprovedunknownsubstrateDetails
DB00490Buspironeapproved, investigationalunknownsubstrateDetails
DB00496Darifenacinapproved, investigationalunknownsubstrateDetails
DB00518Albendazoleapproved, vet_approvedunknownsubstrateDetails
DB00528Lercanidipineapproved, investigationalunknownsubstrateinhibitorDetails
DB00530Erlotinibapproved, investigationalunknownsubstrateinhibitorDetails
DB00533Rofecoxibapproved, investigational, withdrawnunknownsubstrateinducerDetails
DB00539Toremifeneapproved, investigationalunknownsubstrateDetails
DB00541Vincristineapproved, investigationalunknownsubstrateinhibitorDetails
DB00559Bosentanapproved, investigationalunknownsubstrateinducerDetails
DB00570VinblastineapprovedunknownsubstrateinhibitorinducerDetails
DB00582Voriconazoleapproved, investigationalunknownsubstrateinhibitorDetails
DB00584Enalaprilapproved, vet_approvedunknownsubstrateDetails
DB00588Fluticasone propionateapprovedunknownsubstrateinhibitorDetails
DB00593EthosuximideapprovedunknownsubstrateDetails
DB00603Medroxyprogesterone acetateapproved, investigationalunknownsubstrateinducerDetails
DB00604Cisaprideapproved, investigational, withdrawnunknownsubstrateDetails
DB00615Rifabutinapproved, investigationalunknownsubstrateinducerDetails
DB00619ImatinibapprovedunknownsubstrateinhibitorDetails
DB00622Nicardipineapproved, investigationalunknownsubstrateinhibitorDetails
DB00624Testosteroneapproved, investigationalunknownsubstrateinducerDetails
DB00625Efavirenzapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB00635Prednisoneapproved, vet_approvedunknownsubstrateinducerDetails
DB00636Clofibrateapproved, investigationalunknownsubstrateinducerDetails
DB00637Astemizoleapproved, withdrawnunknownsubstrateinhibitorDetails
DB00641SimvastatinapprovedunknownsubstrateinhibitorDetails
DB00643Mebendazoleapproved, vet_approvedunknownsubstrateDetails
DB00673Aprepitantapproved, investigationalunknownsubstrateinhibitorDetails
DB00674GalantamineapprovedunknownsubstrateDetails
DB00675TamoxifenapprovedunknownsubstrateinhibitorinducerDetails
DB00678LosartanapprovedunknownsubstrateinhibitorDetails
DB00683Midazolamapproved, illicitunknownsubstrateinhibitorDetails
DB00696ErgotamineapprovedunknownsubstrateinhibitorDetails
DB00700EplerenoneapprovedunknownsubstrateDetails
DB00701Amprenavirapproved, investigationalunknownsubstrateinhibitorDetails
DB00705DelavirdineapprovedunknownsubstrateinhibitorDetails
DB00717NorethisteroneapprovedunknownsubstrateDetails
DB00731Nateglinideapproved, investigationalunknownsubstrateDetails
DB00736Esomeprazoleapproved, investigationalunknownsubstrateDetails
DB00741Hydrocortisoneapproved, vet_approvedunknownsubstrateinducerDetails
DB00744Zileutonapproved, investigational, withdrawnunknownsubstrateDetails
DB00745Modafinilapproved, investigationalunknownsubstrateinducerDetails
DB00757Dolasetronapproved, investigationalunknownsubstrateDetails
DB00758ClopidogrelapprovedunknownsubstrateDetails
DB00762Irinotecanapproved, investigationalunknownsubstrateDetails
DB00769HydrocortamateapprovedunknowninducerDetails
DB00773EtoposideapprovedunknownsubstrateinducerDetails
DB00778Roxithromycinapproved, investigational, withdrawnunknownsubstrateinhibitorDetails
DB00802Alfentanilapproved, illicitunknownsubstrateDetails
DB00813Fentanylapproved, illicit, investigational, vet_approvedunknownsubstrateDetails
DB00820Tadalafilapproved, investigationalunknownsubstrateDetails
DB00829Diazepamapproved, illicit, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB00834Mifepristoneapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB00836LoperamideapprovedunknownsubstrateinhibitorDetails
DB00843DonepezilapprovedunknownsubstrateDetails
DB00860Prednisoloneapproved, vet_approvedunknownsubstrateinducerDetails
DB00862VardenafilapprovedunknownsubstrateDetails
DB00864Tacrolimusapproved, investigationalunknownsubstrateDetails
DB00872Conivaptanapproved, investigationalunknownsubstrateinhibitorDetails
DB00877Sirolimusapproved, investigationalunknownsubstrateDetails
DB00883Isosorbide dinitrateapproved, investigationalunknownsubstrateDetails
DB00889Granisetronapproved, investigationalunknownsubstrateDetails
DB00897Triazolamapproved, investigationalunknownsubstrateDetails
DB00904OndansetronapprovedunknownsubstrateDetails
DB00906Tiagabineapproved, investigationalunknownsubstrateDetails
DB00907Cocaineapproved, illicitunknownsubstrateDetails
DB00909Zonisamideapproved, investigationalunknownsubstrateDetails
DB00910Paricalcitolapproved, investigationalunknownsubstrateDetails
DB00911Tinidazoleapproved, investigationalunknownsubstrateDetails
DB00918Almotriptanapproved, investigationalunknownsubstrateDetails
DB00921Buprenorphineapproved, illicit, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB00932Tipranavirapproved, investigationalunknownsubstrateinhibitorDetails
DB00938SalmeterolapprovedunknownsubstrateDetails
DB00956Hydrocodoneapproved, illicit, investigationalunknownsubstrateDetails
DB00959Methylprednisoloneapproved, vet_approvedunknownsubstrateinducerDetails
DB00962Zaleplonapproved, illicit, investigationalunknownsubstrateDetails
DB00976TelithromycinapprovedunknownsubstrateinhibitorDetails
DB00977EthinylestradiolapprovedunknownsubstrateDetails
DB00990Exemestaneapproved, investigationalunknownsubstrateDetails
DB00997Doxorubicinapproved, investigationalunknownsubstrateinhibitorDetails
DB01002Levobupivacaineapproved, investigationalunknownsubstrateDetails
DB01006Letrozoleapproved, investigationalunknownsubstrateDetails
DB01008Busulfanapproved, investigationalunknownsubstrateDetails
DB01012CinacalcetapprovedunknownsubstrateDetails
DB01020Isosorbide MononitrateapprovedunknownsubstrateDetails
DB01023Felodipineapproved, investigationalunknownsubstrateinhibitorDetails
DB01026Ketoconazoleapproved, investigationalunknownsubstrateinhibitorDetails
DB01045RifampicinapprovedunknownsubstrateinducerDetails
DB01054Nitrendipineapproved, investigationalunknownsubstrateinhibitorDetails
DB01062Oxybutyninapproved, investigationalunknownsubstrateinhibitorDetails
DB01068Clonazepamapproved, illicitunknownsubstrateDetails
DB01072Atazanavirapproved, investigationalunknownsubstrateinhibitorDetails
DB01076AtorvastatinapprovedunknownsubstrateinducerDetails
DB01100PimozideapprovedunknownsubstrateinhibitorDetails
DB01105Sibutramineapproved, illicit, investigational, withdrawnunknownsubstrateDetails
DB01114ChlorphenamineapprovedunknownsubstrateDetails
DB01115NifedipineapprovedunknownsubstrateinhibitorinducerDetails
DB01126Dutasterideapproved, investigationalunknownsubstrateDetails
DB01129Rabeprazoleapproved, investigationalunknownsubstrateinhibitorDetails
DB01132Pioglitazoneapproved, investigationalunknownsubstrateinducerDetails
DB01149Nefazodoneapproved, withdrawnunknownsubstrateinhibitorDetails
DB01166Cilostazolapproved, investigationalunknownsubstrateDetails
DB01167Itraconazoleapproved, investigationalunknownsubstrateinhibitorDetails
DB01175Escitalopramapproved, investigationalunknownsubstrateinhibitorDetails
DB01184Domperidoneapproved, investigational, vet_approvedunknownsubstrateDetails
DB01190Clindamycinapproved, vet_approvednosubstrateinhibitorDetails
DB01200Bromocriptineapproved, investigationalunknownsubstrateinhibitorDetails
DB01206Lomustineapproved, investigationalunknowninhibitorDetails
DB01211ClarithromycinapprovedunknownsubstrateinhibitorinducerDetails
DB01215Estazolamapproved, illicitunknownsubstrateDetails
DB01216FinasterideapprovedunknownsubstrateDetails
DB01218HalofantrineapprovedunknownsubstrateDetails
DB01222BudesonideapprovedunknownsubstrateinducerDetails
DB01224QuetiapineapprovedunknownsubstrateDetails
DB01227Levomethadyl acetateapproved, investigationalunknownsubstrateDetails
DB01229Paclitaxelapproved, vet_approvedunknownsubstrateinducerDetails
DB01232Saquinavirapproved, investigationalunknownsubstrateinhibitorDetails
DB01234Dexamethasoneapproved, investigational, vet_approvedunknownsubstrateinhibitorinducerDetails
DB01238Aripiprazoleapproved, investigationalunknownsubstrateDetails
DB01254Dasatinibapproved, investigationalunknownsubstrateinhibitorDetails
DB01256RetapamulinapprovedunknownsubstrateDetails
DB01261Sitagliptinapproved, investigationalunknownsubstrateDetails
DB01259Lapatinibapproved, investigationalunknownsubstrateinhibitorDetails
DB01264DarunavirapprovedunknownsubstrateinhibitorDetails
DB01268Sunitinibapproved, investigationalnosubstrateinhibitorDetails
DB01263Posaconazoleapproved, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB01388Mibefradilinvestigational, withdrawnunknownsubstrateinhibitorDetails
DB00197Troglitazoneinvestigational, withdrawnunknowninducerDetails
DB01601LopinavirapprovedunknownsubstrateinhibitorDetails
DB01411PranlukastinvestigationalnosubstrateDetails
DB01410Ciclesonideapproved, investigationalunknownsubstrateDetails
DB00969Alosetronapproved, withdrawnunknownsubstrateDetails
DB04835Maravirocapproved, investigationalunknownsubstrateDetails
DB01409TiotropiumapprovedunknownsubstrateDetails
DB01591SolifenacinapprovedunknownsubstrateDetails
DB01319FosamprenavirapprovedunknownsubstrateinhibitorDetails
DB01011Metyraponeapproved, investigationalunknowninhibitorinducerDetails
DB00377Palonosetronapproved, investigationalunknownsubstrateDetails
DB04856DexloxiglumideinvestigationalunknownDetails
DB04886Calanolide AinvestigationalunknownDetails
DB00580Valdecoxibapproved, investigational, withdrawnunknownsubstrateDetails
DB06144Sertindoleapproved, investigational, withdrawnunknownsubstrateDetails
DB04977PlitidepsininvestigationalunknownDetails
DB04905TesmilifeneinvestigationalunknownsubstrateinhibitorinducerDetails
DB00333MethadoneapprovedunknownsubstrateinhibitorinducerDetails
DB04934RifalazilinvestigationalunknownDetails
DB04957AzimilideinvestigationalunknownDetails
DB00199Erythromycinapproved, investigational, vet_approvednosubstrateinhibitorDetails
DB01628Etoricoxibapproved, investigationalunknownsubstrateinhibitorDetails
DB00564Carbamazepineapproved, investigationalunknownsubstrateinducerDetails
DB06155Rimonabantapproved, investigationalunknownsubstrateDetails
DB06267UdenafilinvestigationalunknownsubstrateDetails
DB06287TemsirolimusapprovedunknownsubstrateDetails
DB06442AvasimibeinvestigationalunknowninducerDetails
DB08502CapravirineinvestigationalunknownDetails
DB06652VicrivirocinvestigationalunknownsubstrateDetails
DB06685LaquinimodinvestigationalunknownsubstrateDetails
DB01095FluvastatinapprovedunknownsubstrateinhibitorinducerDetails
DB00203Sildenafilapproved, investigationalunknownsubstrateDetails
DB00248CabergolineapprovedunknownsubstrateinhibitorDetails
DB00268Ropiniroleapproved, investigationalunknownsubstrateDetails
DB00589Lisurideapproved, investigationalunknownsubstrateDetails
DB01186Pergolideapproved, investigational, vet_approved, withdrawnunknownsubstrateinhibitorDetails
DB05271RotigotineapprovedunknownsubstrateDetails
DB00439Cerivastatinapproved, withdrawnunknownsubstrateinhibitorinducerDetails
DB00257Clotrimazoleapproved, vet_approvedunknowninhibitorinducerDetails
DB00734Risperidoneapproved, investigationalunknownsubstrateinhibitorDetails
DB00338Omeprazoleapproved, investigational, vet_approvedunknownsubstrateinhibitorinducerDetails
DB01037Selegilineapproved, investigational, vet_approvedunknownsubstrateDetails
DB01159Halothaneapproved, vet_approvedunknownsubstrateDetails
DB01181IfosfamideapprovedunknownsubstrateinhibitorinducerDetails
DB01110Miconazoleapproved, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB00814Meloxicamapproved, vet_approvedunknownsubstrateDetails
DB00908Quinidineapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB00656Trazodoneapproved, investigationalunknownsubstrateDetails
DB00176Fluvoxamineapproved, investigationalunknownsubstrateinhibitorDetails
DB00321AmitriptylineapprovedunknownsubstrateDetails
DB00540NortriptylineapprovedunknownsubstrateDetails
DB00215CitalopramapprovedunknownsubstrateinhibitorDetails
DB00924CyclobenzaprineapprovedunknownsubstrateDetails
DB00472Fluoxetineapproved, vet_approvedunknownsubstrateinhibitorDetails
DB01104SertralineapprovedunknownsubstrateinhibitorDetails
DB06148Mianserinapproved, investigationalunknownsubstrateDetails
DB01435Antipyrineapproved, investigationalunknownsubstrateDetails
DB01118Amiodaroneapproved, investigationalunknownsubstrateinhibitorDetails
DB00250Dapsoneapproved, investigationalunknownsubstrateDetails
DB00531Cyclophosphamideapproved, investigationalunknownsubstrateinducerDetails
DB05109Trabectedinapproved, investigationalunknownsubstrateDetails
DB00946Phenprocoumonapproved, investigationalunknownsubstrateDetails
DB00682WarfarinapprovedunknownsubstrateDetails
DB00285VenlafaxineapprovedunknownsubstrateinhibitorDetails
DB00857Terbinafineapproved, investigational, vet_approvedunknownsubstrateinducerDetails
DB00972AzelastineapprovedunknownsubstrateDetails
DB00153Ergocalciferolapproved, nutraceuticalunknownsubstrateDetails
DB00091Cyclosporineapproved, investigational, vet_approvedunknownsubstrateinhibitorinducerDetails
DB00661VerapamilapprovedunknownsubstrateinhibitorDetails
DB00783Estradiolapproved, investigational, vet_approvedunknownsubstrateinducerDetails
DB00396Progesteroneapproved, vet_approvedunknownsubstrateinducerDetails
DB00201CaffeineapprovedunknownsubstrateDetails
DB00318Codeineapproved, illicitunknownsubstrateDetails
DB00514DextromethorphanapprovedunknownsubstrateDetails
DB01248Docetaxelapproved, investigationalunknownsubstrateinhibitorDetails
DB00502HaloperidolapprovedunknownsubstrateinhibitorDetails
DB00281Lidocaineapproved, vet_approvedunknownsubstrateDetails
DB00571Propranololapproved, investigationalunknownsubstrateDetails
DB00501Cimetidineapproved, investigationalunknowninhibitorDetails
DB00446Chloramphenicolapproved, vet_approvedunknowninhibitorDetails
DB00537Ciprofloxacinapproved, investigationalunknowninhibitorDetails
DB01059NorfloxacinapprovedunknowninhibitorDetails
DB06403Ambrisentanapproved, investigationalunknownsubstrateDetails
DB06413Armodafinilapproved, investigationalunknowninducerDetails
DB00865Benzphetamineapproved, illicitunknownsubstrateDetails
DB00612BisoprololapprovedunknownsubstrateDetails
DB01558Bromazepamapproved, illicit, investigationalunknownsubstrateDetails
DB00136Calcitriolapproved, nutraceuticalunknownsubstrateinducerDetails
DB00475Chlordiazepoxideapproved, illicit, investigationalunknownsubstrateDetails
DB00608Chloroquineapproved, investigational, vet_approvedunknownsubstrateDetails
DB00349Clobazamapproved, illicitunknownsubstrateinducerDetails
DB00628Clorazepateapproved, illicitunknownsubstrateDetails
DB01219Dantroleneapproved, investigationalunknownsubstrateDetails
DB01396Digitoxinapproved, investigationalunknownsubstrateDetails
DB04855DronedaroneapprovedunknownsubstrateinhibitorDetails
DB04574Estrone sulfateapprovedunknownsubstrateDetails
DB06414EtravirineapprovedunknownsubstrateinducerDetails
DB01590EverolimusapprovedunknownsubstrateDetails
DB00949FelbamateapprovedunknownsubstrateinducerDetails
DB06702FesoterodineapprovedunknownsubstrateDetails
DB00690Flurazepamapproved, illicit, investigationalunknownsubstrateDetails
DB00499Flutamideapproved, investigationalunknownsubstrateDetails
DB01018Guanfacineapproved, investigationalunknownsubstrateDetails
DB04845Ixabepiloneapproved, investigationalunknownsubstrateinhibitorDetails
DB00448Lansoprazoleapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB00367Levonorgestrelapproved, investigationalunknownsubstrateDetails
DB00358Mefloquineapproved, investigationalunknownsubstrateinhibitorDetails
DB04868Nilotinibapproved, investigationalunknownsubstrateinhibitorDetails
DB06712NilvadipineinvestigationalunknownsubstrateinhibitorDetails
DB00497Oxycodoneapproved, illicit, investigationalunknownsubstrateDetails
DB06589PazopanibapprovedunknownsubstrateinhibitorDetails
DB01621Pipotiazineapproved, investigationalunknownsubstrateDetails
DB01058Praziquantelapproved, investigational, vet_approvedunknownsubstrateDetails
DB01087PrimaquineapprovedunknownsubstrateinhibitorDetails
DB00647Dextropropoxypheneapproved, illicit, investigational, withdrawnunknownsubstrateinhibitorDetails
DB00912Repaglinideapproved, investigationalunknownsubstrateDetails
DB06228RivaroxabanapprovedunknownsubstrateDetails
DB06176Romidepsinapproved, investigationalunknownsubstrateDetails
DB06207SilodosinapprovedunknownsubstrateDetails
DB06145SpiramycinapprovedunknownsubstrateinhibitorDetails
DB00706Tamsulosinapproved, investigationalunknownsubstrateDetails
DB00444TeniposideapprovedunknownsubstrateinhibitorDetails
DB00759Tetracyclineapproved, vet_approvedunknownsubstrateinhibitorDetails
DB00277TheophyllineapprovedunknownsubstrateDetails
DB01036Tolterodineapproved, investigationalunknownsubstrateDetails
DB06212TolvaptanapprovedunknownsubstrateDetails
DB00193Tramadolapproved, investigationalunknownsubstrateDetails
DB00440Trimethoprimapproved, vet_approvedunknownsubstrateDetails
DB00726TrimipramineapprovedunknownsubstrateDetails
DB01198ZopicloneapprovedunknownsubstrateDetails
DB00357Aminoglutethimideapproved, investigationalunknowninducerDetails
DB01320Fosphenytoinapproved, investigationalunknownsubstrateinducerDetails
DB00607Nafcillinapproved, investigationalunknowninducerDetails
DB00776OxcarbazepineapprovedunknowninducerDetails
DB00312Pentobarbitalapproved, investigational, vet_approvedunknowninducerDetails
DB01174Phenobarbitalapproved, investigationalunknowninducerDetails
DB00252Phenytoinapproved, vet_approvedunknownsubstrateinducerDetails
DB00794Primidoneapproved, vet_approvedunknowninducerDetails
DB01201Rifapentineapproved, investigationalunknownsubstrateinducerDetails
DB01394ColchicineapprovedunknownsubstrateinhibitorinducerDetails
DB01253ErgonovineapprovedunknownsubstrateinhibitorDetails
DB01221Ketamineapproved, vet_approvedunknownsubstrateinducerDetails
DB00353MethylergometrineapprovedunknownsubstrateinhibitorDetails
DB06335SaxagliptinapprovedunknownsubstrateDetails
DB00708Sufentanilapproved, investigationalunknownsubstrateDetails
DB01128BicalutamideapprovedunknownsubstrateinhibitorDetails
DB01151Desipramineapproved, investigationalunknowninhibitorDetails
DB00916MetronidazoleapprovedunknowninhibitorDetails
DB06268Sitaxentanapproved, investigational, withdrawnunknowninhibitorDetails
DB00951Isoniazidapproved, investigationalunknowninhibitorDetails
DB01424Aminophenazoneapproved, withdrawnunknownsubstrateDetails
DB00363ClozapineapprovedunknownsubstrateinhibitorinducerDetails
DB00420Promazineapproved, vet_approvedunknownsubstrateDetails
DB01136Carvedilolapproved, investigationalunknownsubstrateDetails
DB00549Zafirlukastapproved, investigationalunknowninhibitorDetails
DB00586Diclofenacapproved, vet_approvedunknownsubstrateDetails
DB00482Celecoxibapproved, investigationalunknownsubstrateDetails
DB01016GlyburideapprovedunknownsubstrateinhibitorDetails
DB01138SulfinpyrazoneapprovedunknownsubstrateinducerDetails
DB06739SeratrodastexperimentalunknownsubstrateinducerDetails
DB06738KetobemidoneexperimentalunknownsubstrateDetails
DB01242Clomipramineapproved, investigational, vet_approvedunknownsubstrateDetails
DB00655EstroneapprovedunknownsubstrateDetails
DB00458ImipramineapprovedunknownsubstrateDetails
DB00546AdinazolamexperimentalunknownsubstrateDetails
DB00231Temazepamapproved, investigationalunknownsubstrateDetails
DB03701VanoxerineinvestigationalunknownsubstrateDetails
DB00169Cholecalciferolapproved, nutraceuticalunknownsubstrateDetails
DB01192Oxymorphoneapproved, investigational, vet_approvedunknownsubstrateDetails
DB01173OrphenadrineapprovedunknownsubstrateinhibitorDetails
DB06772CabazitaxelapprovedunknownsubstrateDetails
DB02709Resveratrolapproved, experimental, investigationalunknowninhibitorDetails
DB06700Desvenlafaxineapproved, investigationalunknownsubstrateinhibitorDetails
DB06697ArtemetherapprovedunknownsubstrateinducerDetails
DB06708LumefantrineapprovedunknownsubstrateinducerDetails
DB00819Acetazolamideapproved, vet_approvedunknowninhibitorDetails
DB01431AllylestrenolexperimentalunknownsubstrateDetails
DB06742AmbroxolinvestigationalunknownsubstrateDetails
DB01223AminophyllineapprovedunknownsubstrateDetails
DB01217Anastrozoleapproved, investigationalunknowninhibitorDetails
DB00278Argatrobanapproved, investigationalunknownsubstrateDetails
DB01169Arsenic trioxideapproved, investigationalunknowninhibitorDetails
DB00289AtomoxetineapprovedunknowninhibitorDetails
DB00719AzatadineapprovedunknowninducerDetails
DB00207AzithromycinapprovedunknownsubstrateDetails
DB01393Bezafibrateapproved, investigationalunknownsubstrateDetails
DB04794Bifonazoleapproved, investigationalunknowninhibitorDetails
DB01194BrinzolamideapprovedunknownsubstrateDetails
DB00835BrompheniramineapprovedunknownsubstrateDetails
DB01156BupropionapprovedunknownsubstrateDetails
DB00748CarbinoxamineapprovedunknownsubstrateDetails
DB00520CaspofunginapprovedunknownsubstrateDetails
DB00567Cephalexinapproved, investigational, vet_approvedunknownsubstrateDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknownsubstrateDetails
DB00356ChlorzoxazoneapprovedunknownsubstrateDetails
DB00845Clofazimineapproved, investigationalunknownsubstrateDetails
DB06470ClomethiazoleinvestigationalunknownsubstrateDetails
DB01559Clotiazepamapproved, illicitunknownsubstrateDetails
DB00987Cytarabineapproved, investigationalunknownsubstrateDetails
DB01406DanazolapprovedunknowninhibitorDetails
DB00694DaunorubicinapprovedunknownsubstrateinhibitorDetails
DB00390DigoxinapprovedunknownsubstrateDetails
DB01551Dihydrocodeineapproved, illicitunknownsubstrateDetails
DB01093Dimethyl sulfoxideapproved, vet_approvedunknowninhibitorDetails
DB00822DisulfiramapprovedunknownsubstrateDetails
DB00869DorzolamideapprovedunknownsubstrateDetails
DB00254Doxycyclineapproved, investigational, vet_approvedunknowninhibitorDetails
DB01127EconazoleapprovedunknowninhibitorDetails
DB00751Epinastineapproved, investigationalunknownsubstrateDetails
DB00668Epinephrineapproved, vet_approvedunknowninhibitorDetails
DB01196Estramustineapproved, investigationalunknownsubstrateDetails
DB00898EthanolapprovedunknownsubstrateinhibitorinducerDetails
DB01466Ethylmorphineexperimental, illicitunknownsubstrateDetails
DB00426Famciclovirapproved, investigationalunknownsubstrateDetails
DB01039FenofibrateapprovedunknownsubstrateDetails
DB00301Flucloxacillinapproved, investigationalunknowninducerDetails
DB01544Flunitrazepamapproved, illicitunknownsubstrateDetails
DB00947Fulvestrantapproved, investigationalunknownsubstrateDetails
DB01067Glipizideapproved, investigationalunknownsubstrateDetails
DB01170GuanethidineapprovedunknowninducerDetails
DB01355HexobarbitalexperimentalunknownsubstrateDetails
DB05381Histamineapproved, investigationalunknownsubstrateinhibitorDetails
DB01275HydralazineapprovedunknowninhibitorDetails
DB00724Imiquimodapproved, investigationalunknownsubstrateDetails
DB01029Irbesartanapproved, investigationalunknowninhibitorDetails
DB00602Ivermectinapproved, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB01321JosamycininvestigationalunknowninhibitorDetails
DB01137Levofloxacinapproved, investigationalunknowninhibitorDetails
DB01103QuinacrineinvestigationalunknownsubstrateDetails
DB01071MequitazineexperimentalunknowninhibitorDetails
DB04817Metamizoleapproved, investigational, withdrawnunknowninducerDetails
DB04833Methaqualoneillicit, withdrawnunknownsubstrateDetails
DB00703MethazolamideapprovedunknowninhibitorDetails
DB01028Methoxyfluraneapproved, investigational, vet_approvedunknownsubstrateDetails
DB06710MethyltestosteroneapprovedunknownsubstrateDetails
DB00379Mexiletineapproved, investigationalunknownsubstrateDetails
DB01204Mitoxantroneapproved, investigationalunknowninhibitorDetails
DB00295Morphineapproved, investigationalunknownsubstrateDetails
DB01183Naloxoneapproved, vet_approvedunknowninhibitorDetails
DB02701Nicotinamideapproved, investigationalunknowninhibitorDetails
DB00184NicotineapprovedunknownsubstrateDetails
DB01595NitrazepamapprovedunknownsubstrateDetails
DB00334Olanzapineapproved, investigationalunknowninhibitorDetails
DB00768OlopatadineapprovedunknownsubstrateDetails
DB00842OxazepamapprovedunknownsubstrateDetails
DB01246Alimemazineapproved, vet_approvedunknowninducerDetails
DB00316AcetaminophenapprovedunknownsubstrateinhibitorinducerDetails
DB01074Perhexilineapproved, investigationalunknownsubstrateDetails
DB04930Permethrinapproved, investigationalunknownsubstrateDetails
DB00850PerphenazineapprovedunknownsubstrateDetails
DB00454MeperidineapprovedunknownsubstrateinducerDetails
DB03783PhenacetinwithdrawnunknownsubstrateDetails
DB00780PhenelzineapprovedunknowninhibitorDetails
DB00812Phenylbutazoneapproved, vet_approvedunknowninducerDetails
DB01085Pilocarpineapproved, investigationalunknowninhibitorDetails
DB01588Prazepamapproved, illicitunknownsubstrateDetails
DB01032Probenecidapproved, investigationalunknowninducerDetails
DB01131ProguanilapprovedunknownsubstrateDetails
DB01182PropafenoneapprovedunknownsubstrateDetails
DB00339Pyrazinamideapproved, investigationalunknownsubstrateDetails
DB00545Pyridostigmineapproved, investigationalunknowninducerDetails
DB01589Quazepamapproved, illicitunknownsubstrateDetails
DB00481Raloxifeneapproved, investigationalunknowninhibitorDetails
DB00863RanitidineapprovedunknownsubstrateDetails
DB01220Rifaximinapproved, investigationalunknownsubstrateinducerDetails
DB00989Rivastigmineapproved, investigationalunknownsubstrateDetails
DB00296RopivacaineapprovedunknownsubstrateDetails
DB01098RosuvastatinapprovedunknownsubstrateinhibitorDetails
DB01698Rutinapproved, experimental, investigationalunknowninhibitorDetails
DB01001Salbutamolapproved, vet_approvedunknowninhibitorDetails
DB01236Sevofluraneapproved, vet_approvedunknownsubstrateDetails
DB00359Sulfadiazineapproved, investigational, vet_approvedunknownsubstrateDetails
DB01015SulfamethoxazoleapprovedunknowninhibitorDetails
DB00259SulfanilamideapprovedunknowninhibitorDetails
DB01349TasosartanexperimentalunknownsubstrateDetails
DB00853Temozolomideapproved, investigationalunknowninducerDetails
DB00763MethimazoleapprovedunknowninhibitorDetails
DB00599Thiopentalapproved, vet_approvedunknowninhibitorDetails
DB04572Thiotepaapproved, investigationalunknownsubstrateDetails
DB01007TioconazoleapprovedunknowninhibitorDetails
DB00273TopiramateapprovedunknowninducerDetails
DB01030Topotecanapproved, investigationalunknowninhibitorinducerDetails
DB00752Tranylcypromineapproved, investigationalunknowninhibitorDetails
DB00347TrimethadioneapprovedunknownsubstrateDetails
DB13179TroleandomycinapprovedunknownsubstrateinhibitorDetails
DB00313Valproic Acidapproved, investigationalunknowninhibitorDetails
DB01392Yohimbineapproved, investigational, vet_approvedunknownsubstrateDetails
DB00495ZidovudineapprovedunknownsubstrateDetails
DB04828ZomepiracwithdrawnunknownsubstrateDetails
DB01380Cortisone acetateapproved, investigationalunknownsubstrateinducerDetails
DB01384ParamethasoneexperimentalunknownsubstrateinhibitorDetails
DB01587KetazolamapprovedunknownsubstrateinhibitorDetails
DB08811TofisopamexperimentalunknowninhibitorDetails
DB00617ParamethadioneapprovedunknownsubstrateDetails
DB00755Tretinoinapproved, investigational, nutraceuticalunknownsubstrateDetails
DB00980Ramelteonapproved, investigationalunknownsubstrateDetails
DB04946IloperidoneapprovedunknownsubstrateDetails
DB01418Acenocoumarolapproved, investigationalunknownsubstrateDetails
DB06684VilazodoneapprovedunknownsubstrateDetails
DB00255Diethylstilbestrolapproved, investigationalunknownsubstrateinhibitorDetails
DB00575ClonidineapprovedunknownsubstrateDetails
DB00973EzetimibeapprovedunknowninhibitorDetails
DB01708Prasteroneapproved, investigational, nutraceuticalunknownsubstrateDetails
DB00400Griseofulvinapproved, investigational, vet_approvedunknowninducerDetails
DB00808IndapamideapprovedunknownsubstrateDetails
DB05521Telaprevirapproved, withdrawnunknownsubstrateinhibitorDetails
DB08820IvacaftorapprovednosubstrateinhibitorDetails
DB06634CasopitantinvestigationalunknownDetails
DB04975BanoxantroneinvestigationalunknownsubstrateDetails
DB05039IndacaterolapprovedunknownsubstrateDetails
DB08816TicagrelorapprovedunknownsubstrateDetails
DB06774CapsaicinapprovedunknowninhibitorDetails
DB06174NoscapineinvestigationalunknowninhibitorDetails
DB01333CefradineapprovedunknowninducerDetails
DB06777Chenodeoxycholic acidapprovedunknownsubstrateDetails
DB00856Chlorphenesinapproved, experimentalunknowninducerDetails
DB04920Clevidipineapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB01764DalfopristinapprovedunknowninhibitorDetails
DB01609Deferasiroxapproved, investigationalunknowninducerDetails
DB00485Dicloxacillinapproved, investigational, vet_approvedunknowninducerDetails
DB06370IndisulaminvestigationalunknowninhibitorDetails
DB01083Orlistatapproved, investigationalunknowninducerDetails
DB00239OxiconazoleapprovedunknowninducerDetails
DB00082PegvisomantapprovedunknowninducerDetails
DB06762PinacidilapprovedunknownsubstrateDetails
DB01369QuinupristinapprovedunknowninhibitorDetails
DB00337Pimecrolimusapproved, investigationalunknownsubstrateinhibitorDetails
DB00041AldesleukinapprovedunknowninhibitorDetails
DB06605ApixabanapprovednosubstrateDetails
DB08827Lomitapideapproved, investigationalnosubstrateDetails
DB08828Vismodegibapproved, investigationalnosubstrateDetails
DB00620Triamcinoloneapproved, vet_approvedunknownsubstrateinducerDetails
DB08864RilpivirineapprovednosubstrateinhibitorDetails
DB06209PrasugrelapprovedyessubstrateDetails
DB06216AsenapineapprovedunknownsubstrateDetails
DB00435Nitric OxideapprovedunknowninhibitorDetails
DB08867UlipristalapprovednosubstrateDetails
DB08815Lurasidoneapproved, investigationalunknownsubstrateDetails
DB08870Brentuximab vedotinapproved, investigationalnosubstrateinhibitorDetails
DB04871LorcaserinapprovednosubstrateDetails
DB05294VandetanibapprovedunknownsubstrateDetails
DB08873Boceprevirapproved, withdrawnunknownsubstrateinhibitorDetails
DB08875Cabozantinibapproved, investigationalnosubstrateDetails
DB08877RuxolitinibapprovedunknownsubstrateDetails
DB05812AbirateroneapprovedunknownsubstrateDetails
DB08881VemurafenibapprovedunknownsubstrateinducerDetails
DB08882LinagliptinapprovedunknownsubstrateinhibitorDetails
DB08883PerampanelapprovednosubstrateinducerDetails
DB08865CrizotinibapprovedunknownsubstrateinhibitorDetails
DB06626Axitinibapproved, investigationalnosubstrateDetails
DB08893MirabegronapprovedunknownsubstrateDetails
DB06237AvanafilapprovedunknownsubstrateDetails
DB08896RegorafenibapprovedunknownsubstrateinhibitorDetails
DB08899EnzalutamideapprovedunknownsubstrateinducerDetails
DB08895Tofacitinibapproved, investigationalnosubstrateDetails
DB06616BosutinibapprovednosubstrateinhibitorDetails
DB08901Ponatinibapproved, investigationalunknownsubstrateDetails
DB08903BedaquilineapprovedunknownsubstrateDetails
DB06201RufinamideapprovedunknownsubstrateinducerDetails
DB08906Fluticasone furoateapprovedunknownsubstrateinhibitorDetails
DB08907CanagliflozinapprovedunknownsubstrateDetails
DB06203AlogliptinapprovedunknownsubstrateDetails
DB04938Ospemifeneapproved, investigationalunknownsubstrateDetails
DB08910PomalidomideapprovedunknownsubstrateDetails
DB08911TrametinibapprovedunknowninducerDetails
DB08912Dabrafenibapproved, investigationalunknownsubstrateinducerDetails
DB05773Trastuzumab emtansineapproved, investigationalunknownsubstrateinhibitorDetails
DB01142Doxepinapproved, investigationalunknownsubstrateDetails
DB00688Mycophenolate mofetilapproved, investigationalunknownsubstrateDetails
DB08918Levomilnacipranapproved, investigationalunknownsubstrateDetails
DB08932MacitentanapprovednosubstrateDetails
DB08933LuliconazoleapprovednoinhibitorDetails
DB06292DapagliflozinapprovednosubstrateDetails
DB09039EliglustatapprovedunknownsubstrateDetails
DB05676Apremilastapproved, investigationalnosubstrateDetails
DB09049NaloxegolapprovedunknownsubstrateDetails
DB09053IbrutinibapprovedunknownsubstrateDetails
DB00951Isoniazidapproved, investigationalunknownDetails
DB09074OlaparibapprovedunknownsubstrateinhibitorDetails
DB09078Lenvatinibapproved, investigationalnosubstrateinhibitorinducerDetails
DB09073Palbociclibapproved, investigationalnosubstrateinhibitorDetails
DB09054IdelalisibapprovednosubstrateinhibitorinducerDetails
DB09068Vortioxetineapproved, investigationalnosubstrateDetails
DB09082VilanterolapprovednosubstrateDetails
DB09083IvabradineapprovedyessubstrateDetails
DB09026Aliskirenapproved, investigationalnosubstrateDetails
DB09101ElvitegravirapprovednosubstrateinhibitorDetails
DB06016Cariprazineapproved, investigationalunknownsubstrateDetails
DB08439ParecoxibapprovedunknownsubstrateDetails
DB09128Brexpiprazoleapproved, investigationalnosubstrateDetails
DB09291Rolapitantapproved, investigationalnosubstrateDetails
DB04908Flibanserinapproved, investigationalnosubstrateDetails
DB09102Daclatasvirapproved, investigationalunknownsubstrateDetails
DB09143Sonidegibapproved, investigationalunknownsubstrateDetails
DB06636Isavuconazoniumapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB06603Panobinostatapproved, investigationalunknownsubstrateDetails
DB05239Cobimetinibapproved, investigationalunknownsubstrateDetails
DB09570Ixazomibapproved, investigationalunknownsubstrateDetails
DB09330OsimertinibapprovednosubstrateinhibitorinducerDetails
DB11362SelexipagapprovednosubstrateDetails
DB09119Eslicarbazepine acetateapprovedyesinducerDetails
DB06789Hydroxyprogesterone caproateapproved, investigationalunknownsubstrateDetails
DB08931RiociguatapprovedunknownsubstrateDetails
DB09183DasabuvirapprovednosubstrateDetails
DB09297Paritaprevirapproved, investigationalnosubstrateDetails
DB09317Synthetic Conjugated Estrogens, AapprovednosubstrateDetails
DB09318Synthetic Conjugated Estrogens, BapprovednosubstrateDetails
DB09389NorgestrelapprovedunknownsubstrateDetails
DB11581Venetoclaxapproved, investigationalnosubstrateDetails
DB09280LumacaftorapprovednoinducerDetails
DB01323St. John's Wortapproved, investigational, nutraceuticalunknowninducerDetails
DB09381Estrogens, esterifiedapprovedunknownsubstrateDetails
DB00957Norgestimateapproved, investigationalunknownsubstrateinducerDetails
DB01395DrospirenoneapprovedunknownsubstrateinducerDetails
DB04911Oritavancinapproved, investigationalunknowninducerDetails
DB06717FosaprepitantapprovedunknownsubstrateinhibitorinducerDetails
DB00648MitotaneapprovedunknowninducerDetails
DB08909Glycerol phenylbutyrateapprovedunknowninducerDetails
DB09048Netupitantapproved, investigationalunknownsubstrateinhibitorDetails
DB09065CobicistatapprovedyessubstrateinhibitorDetails
DB12332Rucaparibapproved, investigationalyessubstrateinhibitordownregulatorDetails
DB11921Deflazacortapproved, investigationalyessubstrateDetails
DB11737Icotinibexperimental, investigationalunknownsubstrateDetails
DB13139Levosalbutamolapproved, investigationalunknowninhibitorDetails
DB06654Safinamideapproved, investigationalunknownsubstrateDetails
DB12161Deutetrabenazineapproved, investigationalyessubstrateDetails
DB09555Dexchlorpheniramine maleateapprovedunknownsubstrateDetails
DB11613Velpatasvirapproved, investigationalnosubstrateDetails
DB05541Brivaracetamapproved, investigationalnosubstrateDetails
DB11915Valbenazineapproved, investigationalnosubstrateDetails
DB06670OdanacatibinvestigationalnosubstrateDetails
DB05351Dexlansoprazoleapproved, investigationalunknownsubstrateDetails
DB06290SimeprevirapprovedunknownsubstrateinhibitorDetails
DB11575GrazoprevirapprovednosubstrateDetails
DB11943Delafloxacinapproved, investigationalunknowninducerDetails
DB01685TopiroxostatexperimentalunknowninhibitorDetails
DB08922PerospironeexperimentalunknownsubstrateDetails
DB09118StiripentolapprovedunknowninhibitorDetails
DB09166EtizolamexperimentalunknownsubstrateDetails
DB11614RupatadineapprovednosubstrateDetails
DB09262ImidafenacininvestigationalnosubstrateDetails
DB00143Glutathioneapproved, investigational, nutraceuticalunknownDetails
DB09238Manidipineapproved, investigationalunknownsubstrateinhibitorDetails
DB09123DienogestapprovedunknownsubstrateDetails
DB11828Neratinibapproved, investigationalunknownsubstrateDetails
DB12026Voxilaprevirapproved, investigationalnosubstrateDetails
DB13874Enasidenibapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB06412Oxymetholoneapproved, illicitunknowninhibitorDetails
DB00503Ritonavirapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB06595Midostaurinapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB11574ElbasvirapprovedunknownsubstrateinhibitorDetails
DB12483Copanlisibapproved, investigationalnosubstrateDetails
DB11767Sarilumabapproved, investigationalnoinhibitorinducerDetails
DB12001Abemaciclibapproved, investigationalunknownsubstrateDetails
DB12267Brigatinibapproved, investigationalnosubstrateDetails
DB11817Baricitinibapproved, investigationalunknownsubstrateDetails
DB13074Macimorelinapproved, investigationalunknownsubstrateDetails
DB09223BlonanserininvestigationalnosubstrateDetails
DB09236Lacidipineapproved, investigationalunknownsubstrateDetails
DB09061Cannabidiolapproved, investigationalunknownsubstrateDetails
DB13943Testosterone cypionateapprovedunknownsubstrateinhibitorinducerDetails
DB13944Testosterone enanthateapprovedunknownsubstrateinhibitorinducerDetails
DB13946Testosterone undecanoateapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB13952Estradiol acetateapproved, investigational, vet_approvedunknownsubstrateinducerDetails
DB13953Estradiol benzoateapproved, investigational, vet_approvedunknownsubstrateinducerDetails
DB13954Estradiol cypionateapproved, investigational, vet_approvedunknownsubstrateinducerDetails
DB13955Estradiol dienanthateapproved, investigational, vet_approvedunknownsubstrateinducerDetails
DB13956Estradiol valerateapproved, investigational, vet_approvedunknownsubstrateinducerDetails
DB13941Piperaquineexperimental, investigationalunknownsubstrateinhibitorDetails
DB01420Testosterone propionateapproved, investigational, vet_approved, withdrawnnosubstrateDetails
DB09195LorpiprazoleapprovednosubstrateDetails
DB11799Bictegravirapproved, investigationalunknownsubstrateDetails
DB11901Apalutamideapproved, investigationalunknownsubstrateinducerDetails
DB09225Zotepineapproved, investigational, withdrawnnosubstrateDetails
DB09230AzelnidipineinvestigationalunknownsubstrateDetails
DB09231BenidipineexperimentalnosubstrateinhibitorDetails
DB09235EfonidipineexperimentalunknownsubstrateinhibitorDetails
DB11642Pitolisantapproved, investigationalunknownsubstrateinducerDetails
DB11633Isavuconazoleapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB09237LevamlodipineexperimentalunknownDetails
DB11712Tezacaftorapproved, investigationalnosubstrateDetails
DB11130Opiumapproved, illicitnosubstrateDetails
DB11251Tocopherolapproved, investigationalnosubstrateDetails
DB14003alpha-Tocopherol acetateapprovednosubstrateDetails
DB11586Asunaprevirapproved, investigational, withdrawnnosubstrateinducerDetails
DB13975Cimicifuga racemosaapproved, experimentalnoinhibitorDetails
DB12278Propiverineapproved, investigationalnosubstrateDetails
DB14011NabiximolsinvestigationalunknownsubstrateDetails
DB14009Medical Cannabisexperimental, investigationalunknownsubstrateDetails
DB11641Vinflunineapproved, investigationalnosubstrateDetails
DB11635TocofersolanapprovednosubstrateDetails
DB11637Delamanidapproved, investigationalnosubstrateDetails
DB13746Bioallethrinapproved, experimentalnosubstrateDetails
DB14019FosnetupitantapprovedunknownsubstrateinhibitorDetails
DB12010Fostamatinibapproved, investigationalunknownsubstrateinhibitorDetails
DB01049Ergoloid mesylateapprovednosubstrateDetails
DB11274Dihydro-alpha-ergocryptineapprovednosubstrateDetails
DB13293Ipecacapproved, withdrawnnosubstrateDetails
DB11198Peppermint oilapproved, investigationalunknowninhibitorDetails
DB13456MidecamycinexperimentalnosubstrateinhibitorDetails
DB12532Oxetacaineapproved, investigationalnoinhibitorDetails
DB11672Curcuminapproved, experimental, investigationalunknowninhibitorDetails
DB11779DanoprevirinvestigationalnoinhibitorDetails
DB09289TianeptineinvestigationalnosubstrateDetails
DB01357MestranolapprovednosubstrateDetails
DB04829Lysergic Acid Diethylamideillicit, investigational, withdrawnnosubstrateDetails
DB00247MethysergideapprovednosubstrateDetails
DB14185Aripiprazole lauroxilapproved, investigationalunknownsubstrateDetails
DB11718Encorafenibapproved, investigationalunknownsubstrateDetails
DB12070Letermovirapproved, investigationalunknowninhibitorDetails
DB14538Hydrocortisone aceponateexperimental, vet_approvedunknownsubstrateinducerDetails
DB14539Hydrocortisone acetateapproved, vet_approvedunknownsubstrateinducerDetails
DB14540Hydrocortisone butyrateapproved, vet_approvedunknownsubstrateinducerDetails
DB14541Hydrocortisone cypionateapproved, investigational, vet_approvedunknownsubstrateDetails
DB14542Hydrocortisone phosphateapproved, vet_approvedunknownsubstrateDetails
DB14543Hydrocortisone probutateapproved, vet_approvedunknownsubstrateinducerDetails
DB14544Hydrocortisone valerateapproved, vet_approvedunknownsubstrateinducerDetails
DB14568Ivosidenibapproved, investigationalunknownsubstrateinducerDetails
DB126293,5-diiodothyropropionic acidinvestigationalnosubstrateDetails
DB014565-androstenedioneexperimental, illicitnosubstrateDetails
DB00240AlclometasoneapprovednosubstrateDetails
DB04630Aldosteroneexperimental, investigationalnosubstrateDetails
DB00288AmcinonideapprovednosubstrateDetails
DB01536Androstenedioneexperimental, illicitnosubstrateDetails
DB00394Beclomethasone dipropionateapproved, investigationalnosubstrateinducerDetails
DB11750Clobetasolapproved, experimental, investigationalnosubstrateinducerDetails
DB01013Clobetasol propionateapprovednosubstrateinducerDetails
DB13158ClobetasoneapprovednosubstrateDetails
DB04652CorticosteroneexperimentalnosubstrateDetails
DB01285Corticotropinapproved, investigational, vet_approvednosubstrateinducerDetails
DB04839Cyproterone acetateapproved, investigationalnosubstrateinhibitorDetails
DB11636NomegestrolapprovednosubstrateDetails
DB13981Nomegestrol acetateinvestigationalnosubstrateDetails
DB00304DesogestrelapprovednosubstrateinhibitorDetails
DB01260Desonideapproved, investigationalnosubstrateinducerDetails
DB06780Desoxycorticosterone acetateapprovednosubstrateDetails
DB01134Desoxycorticosterone Pivalateexperimental, vet_approvednosubstrateDetails
DB11487Dexamethasone isonicotinatevet_approvednosubstrateinhibitorinducerDetails
DB09095Difluocortoloneapproved, investigational, withdrawnnosubstrateDetails
DB06781DifluprednateapprovednosubstrateDetails
DB00378Dydrogesteroneapproved, investigational, withdrawnnosubstrateDetails
DB03515EquileninexperimentalnosubstrateDetails
DB02187EquilinexperimentalnosubstrateDetails
DB13866EthynodiolexperimentalnosubstrateDetails
DB00823Ethynodiol diacetateapprovednosubstrateDetails
DB00687Fludrocortisoneapproved, investigationalnosubstrateinducerDetails
DB00663Flumethasoneapproved, vet_approvednosubstrateDetails
DB00591Fluocinolone acetonideapproved, investigational, vet_approvednosubstrateinducerDetails
DB01047Fluocinonideapproved, investigationalnosubstrateDetails
DB08971Fluocortoloneapproved, withdrawnnosubstrateDetails
DB08970FluprednideneexperimentalnosubstrateDetails
DB09378FluprednisoloneapprovednosubstrateDetails
DB00846FlurandrenolideapprovednosubstrateDetails
DB13867Fluticasoneapproved, experimentalnosubstrateinhibitorDetails
DB08905Formestaneapproved, investigational, withdrawnnoinducerDetails
DB06730GestodeneinvestigationalnosubstrateDetails
DB11619GestrinoneapprovednosubstrateDetails
DB06786Halcinonideapproved, investigational, withdrawnnosubstrateDetails
DB05212HE3286investigationalnosubstrateDetails
DB14545Hydrocortisone succinateapprovedunknownsubstrateinducerDetails
DB14570HydroxyprogesteroneexperimentalnosubstrateDetails
DB00007Leuprolideapproved, investigationalnosubstrateDetails
DB00279Liothyronineapproved, vet_approvednosubstrateDetails
DB01583LiotrixapprovednosubstrateDetails
DB14596Loteprednol etabonateapprovedunknownsubstrateDetails
DB12474Lynestrenolapproved, investigationalnosubstrateDetails
DB09124MedrogestoneapprovednosubstrateDetails
DB00253MedrysoneapprovednosubstrateDetails
DB00351Megestrol acetateapproved, investigational, vet_approvednosubstrateDetails
DB11529Melengestrolvet_approvednosubstrateDetails
DB09383Meprednisoneapproved, investigationalnosubstrateDetails
DB00764Mometasoneapproved, vet_approvednosubstrateDetails
DB14512Mometasone furoateapproved, vet_approvednosubstrateDetails
DB06713Norelgestrominapproved, investigationalnosubstrateDetails
DB09371NorethynodrelapprovednosubstrateDetails
DB01130Prednicarbateapproved, investigationalnosubstrateinducerDetails
DB02789Pregnenoloneapproved, experimentalnosubstrateDetails
DB00896RimexoloneapprovednosubstrateinducerDetails
DB01108Trilostaneapproved, investigational, vet_approved, withdrawnnosubstrateDetails
DB01117AtovaquoneapprovednosubstrateDetails
DB11753Rifamycinapproved, investigationalnosubstrateinducerDetails
DB13857DemegestoneexperimentalnosubstrateDetails
DB14055(S)-Warfarinexperimental, investigationalnosubstrateDetails
DB034104-hydroxycoumarinexperimentalnosubstrateDetails
DB08794Ethyl biscoumacetatewithdrawnunknownsubstrateDetails
DB13136Fluindioneapproved, investigationalnosubstrateDetails
DB01483BarbitalillicitnoinducerDetails
DB01154Thiamylalapproved, vet_approvednosubstrateDetails
DB09229AranidipineexperimentalnosubstrateDetails
DB09227BarnidipineexperimentalnosubstrateinhibitorDetails
DB13488BencyclaneexperimentalnosubstrateDetails
DB01244Bepridilapproved, withdrawnnosubstrateDetails
DB08838Agmatineexperimental, investigationalnosubstrateDetails
DB11960CarboxyamidotriazoleinvestigationalnosubstrateDetails
DB13835CaroverineexperimentalnosubstrateDetails
DB09232CilnidipineinvestigationalnosubstrateDetails
DB00568Cinnarizineapproved, investigationalnosubstrateDetails
DB04838CyclandelateapprovednosubstrateDetails
DB09234DarodipineexperimentalnosubstrateDetails
DB14068DexniguldipineexperimentalnosubstrateDetails
DB14063DexverapamilexperimentalnosubstrateDetails
DB06446DotarizineinvestigationalnosubstrateDetails
DB14064EmopamilexperimentalnosubstrateDetails
DB08992EperisoneinvestigationalnosubstrateDetails
DB08980FendilinewithdrawnnosubstrateDetails
DB13961Fish oilapproved, nutraceuticalnosubstrateDetails
DB04841FlunarizineapprovednosubstrateDetails
DB04842Fluspirileneapproved, investigationalnosubstrateDetails
DB00996Gabapentinapproved, investigationalnosubstrateDetails
DB12923GallopamilinvestigationalnosubstrateDetails
DB00555Lamotrigineapproved, investigationalnosubstrateDetails
DB01202Levetiracetamapproved, investigationalnosubstrateDetails
DB14065LomerizineexperimentalnosubstrateDetails
DB00825MentholapprovednosubstrateDetails
DB12092NaftopidilinvestigationalnosubstrateDetails
DB09239NiguldipineexperimentalnosubstrateDetails
DB09240NiludipineexperimentalnosubstrateDetails
DB04743Nimesulideapproved, investigational, withdrawnnosubstrateDetails
DB06152NylidrinapprovednosubstrateDetails
DB13500Otiloniumexperimental, investigationalnosubstrateDetails
DB09090PinaveriumapprovednosubstrateDetails
DB00230Pregabalinapproved, illicit, investigationalnosubstrateDetails
DB04825PrenylaminewithdrawnnosubstrateDetails
DB12093TetrahydropalmatineinvestigationalnosubstrateDetails
DB14066TetrandrineexperimentalnosubstrateDetails
DB09216Tolfenamic Acidapproved, investigationalnosubstrateDetails
DB07615TranilastinvestigationalnosubstrateDetails
DB09089TrimebutineapprovednosubstrateDetails
DB05885SeletracetaminvestigationalnosubstrateDetails
DB12131VinpocetineinvestigationalnosubstrateDetails
DB13950WIN 55212-2experimentalnosubstrateinhibitorDetails
DB06283ZiconotideapprovednosubstrateDetails
DB040706-Deoxyerythronolide BexperimentalnoinhibitorDetails
DB00681Amphotericin Bapproved, investigationalnoinhibitorDetails
DB07348Brefeldin AexperimentalnoinhibitorDetails
DB11752Bryostatin 1investigationalnoinhibitorDetails
DB01152CandicidinwithdrawnnoinhibitorDetails
DB06419CethromycininvestigationalnoinhibitorDetails
DB06342Coltuximab ravtansineinvestigationalnoinhibitorDetails
DB00954DirithromycinexperimentalnoinhibitorDetails
DB12266EpofolateinvestigationalnoinhibitorDetails
DB01873Epothilone Dexperimental, investigationalnoinhibitorDetails
DB05814GPI-1485investigationalnoinhibitorDetails
DB09309KitasamycinexperimentalnoinhibitorDetails
DB05903KOS-1584investigationalnoinhibitorDetails
DB12089Lorvotuzumab mertansineinvestigationalnoinhibitorDetails
DB12489Mirvetuximab SoravtansineinvestigationalnoinhibitorDetails
DB06587MitemcinalinvestigationalnoinhibitorDetails
DB00826NatamycinapprovednoinhibitorDetails
DB00646Nystatinapproved, vet_approvednoinhibitorDetails
DB03010Patupiloneexperimental, investigationalnoinhibitorDetails
DB06233RidaforolimusinvestigationalnoinhibitorDetails
DB12391SagopiloneinvestigationalnoinhibitorDetails
DB09308SolithromycininvestigationalnoinhibitorDetails
DB11471Tilmicosininvestigational, vet_approvednoinhibitorDetails
DB01241GemfibrozilapprovedunknownsubstrateDetails
DB06791LanreotideapprovednoinhibitorDetails
DB00104Octreotideapproved, investigationalnoinhibitorDetails
DB06663PasireotideapprovednoinhibitorDetails
DB09099Somatostatinapproved, investigationalnoinhibitorDetails
DB04894Vapreotideexperimental, investigationalnoinhibitorDetails
DB12781BalaglitazoneinvestigationalnosubstrateDetails
DB09201CiglitazoneexperimentalnosubstrateDetails
DB09198LobeglitazoneexperimentalnosubstrateDetails
DB09199NetoglitazoneexperimentalnosubstrateDetails
DB09200Rivoglitazoneexperimental, investigationalnosubstrateDetails
DB00412Rosiglitazoneapproved, investigationalnosubstrateDetails
DB09063CeritinibapprovednosubstrateinhibitorDetails
DB06469LestaurtinibinvestigationalnoinhibitorDetails
DB11805SaracatinibinvestigationalnoinhibitorDetails
DB11703Acalabrutinibapproved, investigationalunknowninhibitorDetails
DB01267PaliperidoneapprovedunknownsubstrateDetails
DB01645GenisteininvestigationalunknowninducerDetails
DB05928DovitinibinvestigationalunknowninhibitorDetails
DB08496(R)-warfarinexperimentalunknownsubstrateDetails
DB119196-O-benzylguanineinvestigationalnosubstrateDetails
DB14583Segesterone acetateexperimental, investigationalunknownsubstrateDetails
DB00563MethotrexateapprovednosubstrateDetails
DB04884DapoxetineinvestigationalnosubstrateinhibitorDetails
DB00476DuloxetineapprovednosubstrateinhibitorDetails
DB08953Indalpineinvestigational, withdrawnnosubstrateinhibitorDetails
DB00715Paroxetineapproved, investigationalnoinhibitorDetails
DB04832ZimelidinewithdrawnnoinhibitorDetails
DB04896Milnacipranapproved, investigationalnosubstrateinhibitorDetails
DB02703Fusidic Acidapproved, investigationalunknownsubstrateinhibitorDetails
DB09288PropacetamolexperimentalnosubstrateinhibitorinducerDetails
DB11730Ribociclibapproved, investigationalnosubstrateinhibitorDetails
DB09079NintedanibapprovednosubstrateDetails
DB14634Fluprednidene acetateexperimentalnoDetails
DB14635Curcumin sulfateexperimentalunknownDetails
DB14637Fluprednisolone acetateexperimentalnoDetails
DB01656RoflumilastapprovednosubstrateDetails
DB09034Suvorexantapproved, investigationalnosubstrateDetails
DB09071Tasimelteonapproved, investigationalnosubstrateDetails
DB09030VorapaxarapprovednosubstrateDetails
DB01624Zuclopenthixolapproved, investigationalnosubstrateDetails
DB13385DihydroergocryptineexperimentalnosubstrateDetails
DB11273DihydroergocornineapprovednosubstrateDetails
DB13345Dihydroergocristineapproved, experimentalnosubstrateDetails
DB06218LacosamideapprovednosubstrateDetails
DB12329Eravacyclineapproved, investigationalunknownsubstrateDetails
DB06458RemacemideinvestigationalnoinhibitorDetails
DB08874FidaxomicinapprovednoinhibitorDetails
DB11742Ebastineapproved, investigationalnosubstrateDetails
DB09036Siltuximabapproved, investigationalnoinducerDetails
DB06273TocilizumabapprovednoinducerDetails
DB12301Doravirineapproved, investigationalunknownsubstrateDetails
DB11952Duvelisibapproved, investigationalnosubstrateDetails
DB08930DolutegravirapprovedunknownsubstrateDetails
DB06595Midostaurinapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB13174RheinexperimentalunknowninhibitorDetails
DB11994Diacereinapproved, investigationalunknowninhibitorDetails
DB11605MyrrhapprovedunknowninducerDetails
DB11691Naldemedineapproved, investigationalnosubstrateDetails
DB13878Pibrentasvirapproved, investigationalunknowninhibitorDetails
DB13879Glecaprevirapproved, investigationalunknownsubstrateinhibitorDetails
DB11586Asunaprevirapproved, investigational, withdrawnnosubstrateDetails
DB09568Omega-3-carboxylic acidsapproved, investigationalnosubstrateDetails
DB01601LopinavirapprovednoinhibitorDetails
DB01149Nefazodoneapproved, withdrawnnoinhibitorDetails
DB11431Moxidectininvestigational, vet_approvednosubstrateDetails
DB13141Ambroxol acefyllinateexperimental, investigationalnosubstrateDetails
DB11792MirodenafilinvestigationalunknownsubstrateDetails
DB11979Elagolixapproved, investigationalyessubstrateDetails
DB08865CrizotinibapprovedunknowninhibitorDetails
DB11703Acalabrutinibapproved, investigationalunknownsubstrateDetails
DB12267Brigatinibapproved, investigationalunknowninducerDetails
DB12307ForetinibinvestigationalunknownsubstrateDetails
DB09102Daclatasvirapproved, investigationalunknownsubstrateDetails
DB09205Moxisylyteapproved, investigationalnosubstrateDetails