Alpha-2A adrenergic receptor

Details

Name
Alpha-2A adrenergic receptor
Synonyms
  • ADRA2R
  • ADRAR
  • Alpha-2 adrenergic receptor subtype C10
  • Alpha-2A adrenoceptor
  • Alpha-2A adrenoreceptor
  • Alpha-2AAR
Gene Name
ADRA2A
Organism
Human
Amino acid sequence
>lcl|BSEQ0021255|Alpha-2A adrenergic receptor
MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGG
PQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVA
APPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGPRDTDALDLEESSSSD
HAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKAS
RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSS
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Number of residues
450
Molecular Weight
48956.275
Theoretical pI
10.2
GO Classification
Functions
protein homodimerization activity / thioesterase binding / protein heterodimerization activity / alpha-1B adrenergic receptor binding / alpha-2C adrenergic receptor binding / heterotrimeric G-protein binding / alpha2-adrenergic receptor activity / epinephrine binding / norepinephrine binding / protein kinase binding
Processes
regulation of insulin secretion / positive regulation of cytokine production / thermoception / acute inflammatory response / activation of protein kinase B activity / positive regulation of cell proliferation / activation of protein kinase activity / signal transduction / negative regulation of insulin secretion / glucose homeostasis / adenylate cyclase-inhibiting adrenergic receptor signaling pathway / blood coagulation / negative regulation of lipid catabolic process / actin cytoskeleton organization / epidermal growth factor-activated receptor transactivation by G-protein coupled receptor signaling pathway / Rho protein signal transduction / DNA replication / positive regulation of epidermal growth factor-activated receptor activity / negative regulation of epinephrine secretion / cellular response to hormone stimulus / positive regulation of potassium ion transport / positive regulation of cell migration / negative regulation of insulin secretion involved in cellular response to glucose stimulus / negative regulation of norepinephrine secretion / negative regulation of adrenergic receptor signaling pathway / Ras protein signal transduction / negative regulation of uterine smooth muscle contraction / female pregnancy / negative regulation of calcium ion transmembrane transporter activity / negative regulation of cAMP biosynthetic process / fear response / negative regulation of calcium ion-dependent exocytosis / cell-cell signaling / positive regulation of wound healing / movement of cell or subcellular component / negative regulation of calcium ion transport / phospholipase C-activating adrenergic receptor signaling pathway / platelet activation / energy reserve metabolic process / intestinal absorption / negative regulation of adenylate cyclase activity / positive regulation of vasodilation / regulation of vasoconstriction / G-protein coupled receptor signaling pathway / positive regulation of membrane protein ectodomain proteolysis / positive regulation of MAP kinase activity / activation of MAPK activity by adrenergic receptor signaling pathway / small molecule metabolic process
Components
cytoplasm / integral component of plasma membrane / plasma membrane / receptor complex / basolateral plasma membrane / synapse
General Function
Thioesterase binding
Specific Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins. The rank order of potency for agonists of this receptor is oxymetazoline > clonidine > epinephrine > norepinephrine > phenylephrine > dopamine > p-synephrine > p-tyramine > serotonin = p-octopamine. For antagonists, the rank order is yohimbine > phentolamine = mianserine > chlorpromazine = spiperone = prazosin > propanolol > alprenolol = pindolol.
Pfam Domain Function
Transmembrane Regions
34-59 71-96 107-129 152-172 195-217 375-395 410-429
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0021256|Alpha-2A adrenergic receptor (ADRA2A)
ATGTTCCGCCAGGAGCAGCCGTTGGCCGAGGGCAGCTTTGCGCCCATGGGCTCCCTGCAG
CCGGACGCGGGCAACGCGAGCTGGAACGGGACCGAGGCGCCGGGGGGCGGCGCCCGGGCC
ACCCCTTACTCCCTGCAGGTGACGCTGACGCTGGTGTGCCTGGCCGGCCTGCTCATGCTG
CTCACCGTGTTCGGCAACGTGCTCGTCATCATCGCCGTGTTCACGAGCCGCGCGCTCAAG
GCGCCCCAAAACCTCTTCCTGGTGTCTCTGGCCTCGGCCGACATCCTGGTGGCCACGCTC
GTCATCCCTTTCTCGCTGGCCAACGAGGTCATGGGCTACTGGTACTTCGGCAAGGCTTGG
TGCGAGATCTACCTGGCGCTCGACGTGCTCTTCTGCACGTCGTCCATCGTGCACCTGTGC
GCCATCAGCCTGGACCGCTACTGGTCCATCACACAGGCCATCGAGTACAACCTGAAGCGC
ACGCCGCGCCGCATCAAGGCCATCATCATCACCGTGTGGGTCATCTCGGCCGTCATCTCC
TTCCCGCCGCTCATCTCCATCGAGAAGAAGGGCGGCGGCGGCGGCCCGCAGCCGGCCGAG
CCGCGCTGCGAGATCAACGACCAGAAGTGGTACGTCATCTCGTCGTGCATCGGCTCCTTC
TTCGCTCCCTGCCTCATCATGATCCTGGTCTACGTGCGCATCTACCAGATCGCCAAGCGT
CGCACCCGCGTGCCACCCAGCCGCCGGGGTCCGGACGCCGTCGCCGCGCCGCCGGGGGGC
ACCGAGCGCAGGCCCAACGGTCTGGGCCCCGAGCGCAGCGCGGGCCCGGGGGGCGCAGAG
GCCGAACCGCTGCCCACCCAGCTCAACGGCGCCCCTGGCGAGCCCGCGCCGGCCGGGCCG
CGCGACACCGACGCGCTGGACCTGGAGGAGAGCTCGTCTTCCGACCACGCCGAGCGGCCT
CCAGGGCCCCGCAGACCCGAGCGCGGTCCCCGGGGCAAAGGCAAGGCCCGAGCGAGCCAG
GTGAAGCCGGGCGACAGCCTGCCGCGGCGCGGGCCGGGGGCGACGGGGATCGGGACGCCG
GCTGCAGGGCCGGGGGAGGAGCGCGTCGGGGCTGCCAAGGCGTCGCGCTGGCGCGGGCGG
CAGAACCGCGAGAAGCGCTTCACGTTCGTGCTGGCCGTGGTCATCGGAGTGTTCGTGGTG
TGCTGGTTCCCCTTCTTCTTCACCTACACGCTCACGGCCGTCGGGTGCTCCGTGCCACGC
ACGCTCTTCAAATTCTTCTTCTGGTTCGGCTACTGCAACAGCTCGTTGAACCCGGTCATC
TACACCATCTTCAACCACGATTTCCGCCGCGCCTTCAAGAAGATCCTCTGTCGGGGGGAC
AGGAAGCGGATCGTGTGA
Chromosome Location
10
Locus
10q24-q26
External Identifiers
ResourceLink
UniProtKB IDP08913
UniProtKB Entry NameADA2A_HUMAN
GenBank Protein ID178196
GenBank Gene IDM23533
GenAtlas IDADRA2A
HGNC IDHGNC:281
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00449DipivefrinapprovedyesagonistDetails
DB00484BrimonidineapprovedyesagonistDetails
DB00575ClonidineapprovedyesagonistDetails
DB00629Guanabenzapproved, investigationalyesagonistDetails
DB00633Dexmedetomidineapproved, vet_approvedyesagonistDetails
DB00692PhentolamineapprovedyesantagonistDetails
DB00697Tizanidineapproved, investigationalunknownagonistDetails
DB00865Benzphetamineapproved, illicityesagonistDetails
DB00964ApraclonidineapprovedyesagonistDetails
DB00968MethyldopaapprovedyesDetails
DB01018Guanfacineapproved, investigationalyesagonistDetails
DB00370MirtazapineapprovedyesantagonistDetails
DB00656Trazodoneapproved, investigationalnoantagonistDetails
DB00800FenoldopamapprovedunknownantagonistDetails
DB00852PseudoephedrineapprovedyesagonistDetails
DB00935Oxymetazolineapproved, investigationalyesagonistpartial agonistDetails
DB01392Yohimbineapproved, investigational, vet_approvedyesantagonistDetails
DB00321AmitriptylineapprovednoantagonistDetails
DB014724-Methoxyamphetamineexperimental, illicityesagonistDetails
DB00368NorepinephrineapprovedyesagonistDetails
DB00696Ergotamineapprovedunknownpartial agonistDetails
DB04855DronedaroneapprovedunknownDetails
DB00751Epinastineapproved, investigationalunknownunknownDetails
DB06148Mianserinapproved, investigationalunknownantagonistDetails
DB04948Lofexidineapproved, investigationalyesagonistDetails
DB05492Epicept NP-1investigationalunknownDetails
DB06262Droxidopaapproved, investigationalyesagonistDetails
DB06216AsenapineapprovedunknownantagonistDetails
DB06229OcaperidoneinvestigationalunknownDetails
DB06623Flupirtineapproved, investigationalunknownDetails
DB06694Xylometazolineapproved, investigationalyesagonistDetails
DB01186Pergolideapproved, investigational, vet_approved, withdrawnunknownagonistDetails
DB01200Bromocriptineapproved, investigationalunknownagonistDetails
DB00589Lisurideapproved, investigationalunknownother/unknownDetails
DB00248CabergolineapprovedunknownantagonistDetails
DB00413Pramipexoleapproved, investigationalunknownpartial agonistDetails
DB00268Ropiniroleapproved, investigationalunknownagonistDetails
DB00714Apomorphineapproved, investigationalunknownagonistDetails
DB00734Risperidoneapproved, investigationalunknownantagonistDetails
DB01267PaliperidoneapprovedunknownantagonistDetails
DB01224QuetiapineapprovedunknownantagonistDetails
DB00246ZiprasidoneapprovednoantagonistDetails
DB00363ClozapineapprovednoantagonistDetails
DB01238Aripiprazoleapproved, investigationalnoantagonistDetails
DB00334Olanzapineapproved, investigationalunknownantagonistDetails
DB01403Methotrimeprazineapproved, investigationalunknownantagonistDetails
DB01608Propericiazineapproved, investigationalyesantagonistDetails
DB01624Zuclopenthixolapproved, investigationalunknownantagonistDetails
DB01149Nefazodoneapproved, withdrawnunknownantagonistDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB00797Tolazolineapproved, vet_approvedunknownantagonistDetails
DB00320Dihydroergotamineapproved, investigationalunknownagonistDetails
DB01142Doxepinapproved, investigationalunknownantagonistDetails
DB06711NaphazolineapprovedyesagonistDetails
DB00925PhenoxybenzamineapprovedyesantagonistDetails
DB01363Ephedraapproved, nutraceutical, withdrawnyesagonistDetails
DB01577Methamphetamineapproved, illicityesagonistDetails
DB00668Epinephrineapproved, vet_approvedyesagonistDetails
DB08815Lurasidoneapproved, investigationalunknownDetails
DB00408LoxapineapprovedunknownbinderDetails
DB01136Carvedilolapproved, investigationalunknownantagonistDetails
DB00726Trimipramineapprovedunknowndesensitize the targetDetails
DB00457PrazosinapprovedunknownbinderDetails
DB09242Moxonidineapproved, investigationalyesagonistDetails
DB11738Rilmenidineapproved, investigationalunknownDetails
DB00555Lamotrigineapproved, investigationalunknowninhibitorDetails
DB09244PirlindoleapprovedunknownantagonistDetails
DB09286Pipamperoneapproved, investigationalunknownantagonistDetails
DB11124RacepinephrineapprovedyesagonistDetails
DB06153PizotifenapprovedunknownantagonistDetails
DB11278DL-MethylephedrineapprovedyesagonistDetails
DB04846Celiprololapproved, investigationalunknownantagonistDetails
DB14185Aripiprazole lauroxilapproved, investigationalnoDetails
DB00217BethanidineapprovedyesagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB00540NortriptylineapprovedunknownantagonistDetails
DB00934Maprotilineapproved, investigationalunknownantagonistDetails
DB01151Desipramineapproved, investigationalunknownbinderDetails
DB09202CirazolineexperimentalyesantagonistDetails
DB06678EsmirtazapineinvestigationalunknownantagonistDetails
DB06707LevonordefrinapprovedyesagonistDetails
DB13025Tiaprideapproved, investigationalyesantagonistDetails
DB09167DosulepinapprovedyesantagonistDetails
DB09304SetiptilineapprovedunknownantagonistDetails
DB00397Phenylpropanolamineapproved, vet_approved, withdrawnunknownDetails
DB09194EtoperidonewithdrawnunknownantagonistDetails
DB09195LorpiprazoleapprovedyesantagonistDetails
DB11477Xylazinevet_approvedyesagonistDetails
DB01365MephentermineapprovedyesagonistDetails
DB00182Amphetamineapproved, illicit, investigationalunknownagonistDetails
DB09205Moxisylyteapproved, investigationalyesantagonistDetails
DB09229Aranidipineapproved, investigationalunknownagonistDetails
DB11577Indigotindisulfonic AcidapprovednoagonistDetails
DB13345Dihydroergocristineapproved, experimentalyesantagonistagonistDetails
DB01049Ergoloid mesylateapprovedyesantagonistagonistDetails
DB11273DihydroergocornineapprovedyesantagonistagonistDetails
DB11278DL-MethylephedrineapprovedyesagonistDetails