pH-gated potassium channel KcsA

Details

Name
pH-gated potassium channel KcsA
Synonyms
  • skc1
  • Streptomyces lividans K+ channel
Gene Name
kcsA
Organism
Streptomyces lividans
Amino acid sequence
>lcl|BSEQ0010947|pH-gated potassium channel KcsA
MPPMLSGLLARLVKLLLGRHGSALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLI
TYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQE
RRGHFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR
Number of residues
160
Molecular Weight
17693.465
Theoretical pI
10.66
GO Classification
Functions
identical protein binding / voltage-gated potassium channel activity
Components
voltage-gated potassium channel complex
General Function
Voltage-gated potassium channel activity
Specific Function
Acts as a pH-gated potassium ion channel; changing the cytosolic pH from 7 to 4 opens the channel, although it is not clear if this is the physiological stimulus for channel opening. Monovalent cation preference is K(+) > Rb(+) > NH4(+) >> Na(+) > Li(+).
Pfam Domain Function
Transmembrane Regions
28-50 88-111
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0002690|483 bp
ATGCCACCCATGCTGTCCGGTCTTCTGGCCAGATTGGTCAAACTGCTGCTCGGGCGCCAC
GGCAGTGCGCTGCACTGGAGGGCCGCGGGTGCCGCGACGGTCCTCCTGGTGATCGTCCTC
CTCGCGGGCTCGTACTTGGCCGTCCTGGCTGAGCGCGGCGCACCGGGCGCGCAGCTGATC
ACGTATCCGCGGGCGCTGTGGTGGTCCGTGGAGACCGCGACGACCGTCGGCTACGGCGAC
CTGTACCCCGTGACTCTGTGGGGCCGGCTCGTGGCCGTGGTGGTGATGGTCGCCGGGATC
ACCTCCTTCGGTCTGGTGACCGCCGCGCTGGCCACCTGGTTCGTCGGCCGGGAACAAGAG
CGCCGGGGCCACTTCGTGCGCCACTCCGAGAAGGCCGCCGAGGAGGCGTACACGCGGACG
ACCCGGGCGCTGCACGAGCGTTTCGACCGTTTGGAGCGAATGCTCGACGACAACCGCCGG
TGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0A334
UniProtKB Entry NameKCSA_STRLI
GenBank Protein ID1089906
GenBank Gene IDZ37969
General References
  1. Schrempf H, Schmidt O, Kummerlen R, Hinnah S, Muller D, Betzler M, Steinkamp T, Wagner R: A prokaryotic potassium ion channel with two predicted transmembrane segments from Streptomyces lividans. EMBO J. 1995 Nov 1;14(21):5170-8. [Article]
  2. Cuello LG, Romero JG, Cortes DM, Perozo E: pH-dependent gating in the Streptomyces lividans K+ channel. Biochemistry. 1998 Mar 10;37(10):3229-36. [Article]
  3. le Coutre J, Whitelegge JP, Gross A, Turk E, Wright EM, Kaback HR, Faull KF: Proteomics on full-length membrane proteins using mass spectrometry. Biochemistry. 2000 Apr 18;39(15):4237-42. [Article]
  4. Hirano M, Takeuchi Y, Aoki T, Yanagida T, Ide T: Rearrangements in the KcsA cytoplasmic domain underlie its gating. J Biol Chem. 2010 Feb 5;285(6):3777-83. doi: 10.1074/jbc.M109.084368. Epub 2009 Dec 3. [Article]
  5. Gouaux E: Single potassium ion seeks open channel for transmembrane travels: tales from the KcsA structure. Structure. 1998 Oct 15;6(10):1221-6. [Article]
  6. Doyle DA, Morais Cabral J, Pfuetzner RA, Kuo A, Gulbis JM, Cohen SL, Chait BT, MacKinnon R: The structure of the potassium channel: molecular basis of K+ conduction and selectivity. Science. 1998 Apr 3;280(5360):69-77. [Article]
  7. Cortes DM, Cuello LG, Perozo E: Molecular architecture of full-length KcsA: role of cytoplasmic domains in ion permeation and activation gating. J Gen Physiol. 2001 Feb;117(2):165-80. [Article]
  8. Liu YS, Sompornpisut P, Perozo E: Structure of the KcsA channel intracellular gate in the open state. Nat Struct Biol. 2001 Oct;8(10):883-7. [Article]
  9. Morais-Cabral JH, Zhou Y, MacKinnon R: Energetic optimization of ion conduction rate by the K+ selectivity filter. Nature. 2001 Nov 1;414(6859):37-42. [Article]
  10. Zhou Y, Morais-Cabral JH, Kaufman A, MacKinnon R: Chemistry of ion coordination and hydration revealed by a K+ channel-Fab complex at 2.0 A resolution. Nature. 2001 Nov 1;414(6859):43-8. [Article]
  11. Uysal S, Vasquez V, Tereshko V, Esaki K, Fellouse FA, Sidhu SS, Koide S, Perozo E, Kossiakoff A: Crystal structure of full-length KcsA in its closed conformation. Proc Natl Acad Sci U S A. 2009 Apr 21;106(16):6644-9. doi: 10.1073/pnas.0810663106. Epub 2009 Apr 3. [Article]
  12. Uysal S, Cuello LG, Cortes DM, Koide S, Kossiakoff AA, Perozo E: Mechanism of activation gating in the full-length KcsA K+ channel. Proc Natl Acad Sci U S A. 2011 Jul 19;108(29):11896-9. doi: 10.1073/pnas.1105112108. Epub 2011 Jul 5. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01851Tetrabutylammonium IonexperimentalunknownDetails
DB07416(2S)-2-(BUTYRYLOXY)-3-HYDROXYPROPYL NONANOATEexperimentalunknownDetails
DB08837Tetraethylammoniumexperimental, investigationalunknowninhibitorDetails