30S ribosomal protein S8
Details
- Name
- 30S ribosomal protein S8
- Synonyms
- Not Available
- Gene Name
- rpsH
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0019611|30S ribosomal protein S8 MSMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELE LTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAG LGGEIICYVA
- Number of residues
- 130
- Molecular Weight
- 14126.435
- Theoretical pI
- Not Available
- GO Classification
- FunctionsrRNA binding / structural constituent of ribosomeProcessesregulation of mRNA stability / regulation of translation / translationComponentscytosol / cytosolic small ribosomal subunit
- General Function
- Structural constituent of ribosome
- Specific Function
- One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit.Protein S8 is a translational repressor protein, it controls the translation of the spc operon by binding to its mRNA.
- Pfam Domain Function
- Ribosomal_S8 (PF00410)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0019612|30S ribosomal protein S8 (rpsH) ATGAGCATGCAAGATCCGATCGCGGATATGCTGACCCGTATCCGTAACGGTCAGGCCGCG AACAAAGCTGCGGTCACCATGCCTTCCTCCAAGCTGAAAGTGGCAATCGCCAACGTGCTG AAGGAAGAAGGTTTTATTGAAGATTTTAAAGTTGAAGGCGACACCAAGCCTGAACTGGAA CTTACTCTGAAGTATTTCCAGGGCAAAGCTGTTGTAGAAAGCATTCAGCGTGTCAGCCGC CCAGGTCTGCGCATCTATAAACGTAAAGATGAGCTGCCGAAAGTTATGGCGGGTCTGGGT ATCGCAGTTGTTTCTACCTCTAAAGGTGTTATGACTGATCGTGCAGCGCGCCAGGCTGGT CTTGGTGGCGAAATTATCTGCTACGTAGCCTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0A7W7 UniProtKB Entry Name RS8_ECOLI - General References
- Cerretti DP, Dean D, Davis GR, Bedwell DM, Nomura M: The spc ribosomal protein operon of Escherichia coli: sequence and cotranscription of the ribosomal protein genes and a protein export gene. Nucleic Acids Res. 1983 May 11;11(9):2599-616. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Allen G, Wittmann-Liebold B: The amino acid sequence of the ribosomal protein S8 of Escherichia coli. Hoppe Seylers Z Physiol Chem. 1978 Nov;359(11):1509-25. [Article]
- Olins PO, Nomura M: Translational regulation by ribosomal protein S8 in Escherichia coli: structural homology between rRNA binding site and feedback target on mRNA. Nucleic Acids Res. 1981 Apr 10;9(7):1757-64. [Article]
- Wower I, Kowaleski MP, Sears LE, Zimmermann RA: Mutagenesis of ribosomal protein S8 from Escherichia coli: defects in regulation of the spc operon. J Bacteriol. 1992 Feb;174(4):1213-21. [Article]
- VanBogelen RA, Abshire KZ, Moldover B, Olson ER, Neidhardt FC: Escherichia coli proteome analysis using the gene-protein database. Electrophoresis. 1997 Aug;18(8):1243-51. [Article]
- Arnold RJ, Reilly JP: Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry. Anal Biochem. 1999 Apr 10;269(1):105-12. [Article]
- Tung CS, Joseph S, Sanbonmatsu KY: All-atom homology model of the Escherichia coli 30S ribosomal subunit. Nat Struct Biol. 2002 Oct;9(10):750-5. [Article]
- Gao H, Sengupta J, Valle M, Korostelev A, Eswar N, Stagg SM, Van Roey P, Agrawal RK, Harvey SC, Sali A, Chapman MS, Frank J: Study of the structural dynamics of the E coli 70S ribosome using real-space refinement. Cell. 2003 Jun 13;113(6):789-801. [Article]
- Schuwirth BS, Borovinskaya MA, Hau CW, Zhang W, Vila-Sanjurjo A, Holton JM, Cate JH: Structures of the bacterial ribosome at 3.5 A resolution. Science. 2005 Nov 4;310(5749):827-34. [Article]