Pyridoxine/pyridoxamine 5'-phosphate oxidase
Details
- Name
- Pyridoxine/pyridoxamine 5'-phosphate oxidase
- Synonyms
- 1.4.3.5
- PNP/PMP oxidase
- PNPOx
- Pyridoxal 5'-phosphate synthase
- Gene Name
- pdxH
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0016666|Pyridoxine/pyridoxamine 5'-phosphate oxidase MSDNDELQQIAHLRREYTKGGLRRRDLPADPLTLFERWLSQACEAKLADPTAMVVATVDE HGQPYQRIVLLKHYDEKGMVFYTNLGSRKAHQIENNPRVSLLFPWHTLERQVMVIGKAER LSTLEVMKYFHSRPRDSQIGAWVSKQSSRISARGILESKFLELKQKFQQGEVPLPSFWGG FRVSLEQIEFWQGGEHRLHDRFLYQRENDAWKIDRLAP
- Number of residues
- 218
- Molecular Weight
- 25544.975
- Theoretical pI
- 9.6
- GO Classification
- FunctionsFMN binding / oxidoreductase activity / pyridoxamine-phosphate oxidase activityProcessesoxidation-reduction process / pyridoxal 5'-phosphate salvage / pyridoxine biosynthetic processComponentscytosol
- General Function
- Pyridoxamine-phosphate oxidase activity
- Specific Function
- Catalyzes the oxidation of either pyridoxine 5'-phosphate (PNP) or pyridoxamine 5'-phosphate (PMP) into pyridoxal 5'-phosphate (PLP).
- Pfam Domain Function
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0016667|Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) ATGTCTGATAACGACGAATTGCAGCAAATCGCGCATCTGCGCCGTGAATACACCAAAGGC GGGTTACGCCGCCGCGATCTTCCCGCCGATCCATTAACCCTTTTTGAACGTTGGCTCTCT CAGGCTTGTGAAGCCAAACTGGCGGACCCTACCGCGATGGTGGTCGCTACCGTGGATGAA CATGGTCAGCCTTATCAGCGCATCGTTTTACTCAAACATTACGACGAAAAAGGCATGGTG TTTTACACCAACCTCGGCAGCCGTAAAGCACATCAAATCGAAAATAATCCGCGCGTTAGC CTGCTGTTCCCGTGGCATACCCTTGAGCGCCAGGTGATGGTGATCGGTAAAGCAGAACGA CTTTCGACTCTCGAAGTGATGAAATATTTTCATAGCCGCCCGCGTGATAGCCAGATTGGT GCATGGGTTTCGAAGCAGTCCAGTCGCATTTCTGCCCGCGGTATCCTTGAAAGTAAATTC CTGGAGCTGAAGCAGAAGTTTCAACAGGGCGAAGTGCCATTGCCGAGCTTTTGGGGCGGT TTTCGCGTCAGCCTTGAACAGATTGAGTTCTGGCAGGGTGGTGAGCATCGCCTGCATGAC CGCTTTTTGTACCAGCGTGAAAATGATGCGTGGAAGATTGATCGTCTTGCACCCTGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0AFI7 UniProtKB Entry Name PDXH_ECOLI GenBank Gene ID M92351 - General References
- Lam HM, Winkler ME: Characterization of the complex pdxH-tyrS operon of Escherichia coli K-12 and pleiotropic phenotypes caused by pdxH insertion mutations. J Bacteriol. 1992 Oct;174(19):6033-45. [Article]
- Aiba H, Baba T, Hayashi K, Inada T, Isono K, Itoh T, Kasai H, Kashimoto K, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Horiuchi T, et al.: A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map. DNA Res. 1996 Dec 31;3(6):363-77. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Zhao G, Winkler ME: Kinetic limitation and cellular amount of pyridoxine (pyridoxamine) 5'-phosphate oxidase of Escherichia coli K-12. J Bacteriol. 1995 Feb;177(4):883-91. [Article]
- Di Salvo M, Yang E, Zhao G, Winkler ME, Schirch V: Expression, purification, and characterization of recombinant Escherichia coli pyridoxine 5'-phosphate oxidase. Protein Expr Purif. 1998 Aug;13(3):349-56. [Article]
- Safo MK, Mathews I, Musayev FN, di Salvo ML, Thiel DJ, Abraham DJ, Schirch V: X-ray structure of Escherichia coli pyridoxine 5'-phosphate oxidase complexed with FMN at 1.8 A resolution. Structure. 2000 Jul 15;8(7):751-62. [Article]
- Safo MK, Musayev FN, di Salvo ML, Schirch V: X-ray structure of Escherichia coli pyridoxine 5'-phosphate oxidase complexed with pyridoxal 5'-phosphate at 2.0 A resolution. J Mol Biol. 2001 Jul 20;310(4):817-26. [Article]
- di Salvo ML, Ko TP, Musayev FN, Raboni S, Schirch V, Safo MK: Active site structure and stereospecificity of Escherichia coli pyridoxine-5'-phosphate oxidase. J Mol Biol. 2002 Jan 18;315(3):385-97. [Article]
- Safo MK, Musayev FN, Schirch V: Structure of Escherichia coli pyridoxine 5'-phosphate oxidase in a tetragonal crystal form: insights into the mechanistic pathway of the enzyme. Acta Crystallogr D Biol Crystallogr. 2005 May;61(Pt 5):599-604. Epub 2005 Apr 20. [Article]