Cytochrome P450 2C8

Details

Name
Cytochrome P450 2C8
Synonyms
  • 1.14.14.1
  • CYPIIC8
  • Cytochrome P450 form 1
  • Cytochrome P450 IIC2
  • Cytochrome P450 MP-12
  • Cytochrome P450 MP-20
  • S-mephenytoin 4-hydroxylase
Gene Name
CYP2C8
Organism
Human
Amino acid sequence
>lcl|BSEQ0005650|Cytochrome P450 2C8
MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKV
YGPVFTVYFGMNPIVVFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRW
KEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICS
VVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALT
RSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTE
TTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSD
LVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFK
KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLP
PSYQICFIPV
Number of residues
490
Molecular Weight
55824.275
Theoretical pI
8.62
GO Classification
Functions
iron ion binding / heme binding / monooxygenase activity / oxygen binding / aromatase activity / caffeine oxidase activity / oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen / arachidonic acid epoxygenase activity / steroid hydroxylase activity
Processes
organic acid metabolic process / arachidonic acid metabolic process / drug metabolic process / epoxygenase P450 pathway / exogenous drug catabolic process / omega-hydroxylase P450 pathway / small molecule metabolic process / oxidative demethylation / oxidation-reduction process / xenobiotic metabolic process
Components
cytoplasm / endoplasmic reticulum membrane / intracellular membrane-bounded organelle
General Function
Steroid hydroxylase activity
Specific Function
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. In the epoxidation of arachidonic acid it generates only 14,15- and 11,12-cis-epoxyeicosatrienoic acids. It is the principal enzyme responsible for the metabolism the anti-cancer drug paclitaxel (taxol).
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Endoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0021338|Cytochrome P450 2C8 (CYP2C8)
ATGGAACCTTTTGTGGTCCTGGTGCTGTGTCTCTCTTTTATGCTTCTCTTTTCACTCTGG
AGACAGAGCTGTAGGAGAAGGAAGCTCCCTCCTGGCCCCACTCCTCTTCCTATTATTGGA
AATATGCTACAGATAGATGTTAAGGACATCTGCAAATCTTTCACCAATTTCTCAAAAGTC
TATGGTCCTGTGTTCACCGTGTATTTTGGCATGAATCCCATAGTGGTGTTTCATGGATAT
GAGGCAGTGAAGGAAGCCCTGATTGATAATGGAGAGGAGTTTTCTGGAAGAGGCAATTCC
CCAATATCTCAAAGAATTACTAAAGGACTTGGAATCATTTCCAGCAATGGAAAGAGATGG
AAGGAGATCCGGCGTTTCTCCCTCACAACCTTGCGGAATTTTGGGATGGGGAAGAGGAGC
ATTGAGGACCGTGTTCAAGAGGAAGCTCACTGCCTTGTGGAGGAGTTGAGAAAAACCAAG
GCTTCACCCTGTGATCCCACTTTCATCCTGGGCTGTGCTCCCTGCAATGTGATCTGCTCC
GTTGTTTTCCAGAAACGATTTGATTATAAAGATCAGAATTTTCTCACCCTGATGAAAAGA
TTCAATGAAAACTTCAGGATTCTGAACTCCCCATGGATCCAGGTCTGCAATAATTTCCCT
CTACTCATTGATTGTTTCCCAGGAACTCACAACAAAGTGCTTAAAAATGTTGCTCTTACA
CGAAGTTACATTAGGGAGAAAGTAAAAGAACACCAAGCATCACTGGATGTTAACAATCCT
CGGGACTTTATCGATTGCTTCCTGATCAAAATGGAGCAGGAAAAGGACAACCAAAAGTCA
GAATTCAATATTGAAAACTTGGTTGGCACTGTAGCTGATCTATTTGTTGCTGGAACAGAG
ACAACAAGCACCACTCTGAGATATGGACTCCTGCTCCTGCTGAAGCACCCAGAGGTCACA
GCTAAAGTCCAGGAAGAGATTGATCATGTAATTGGCAGACACAGGAGCCCCTGCATGCAG
GATAGGAGCCACATGCCTTACACTGATGCTGTAGTGCACGAGATCCAGAGATACAGTGAC
CTTGTCCCCACCGGTGTGCCCCATGCAGTGACCACTGATACTAAGTTCAGAAACTACCTC
ATCCCCAAGGGCACAACCATAATGGCATTACTGACTTCCGTGCTACATGATGACAAAGAA
TTTCCTAATCCAAATATCTTTGACCCTGGCCACTTTCTAGATAAGAATGGCAACTTTAAG
AAAAGTGACTACTTCATGCCTTTCTCAGCAGGAAAACGAATTTGTGCAGGAGAAGGACTT
GCCCGCATGGAGCTATTTTTATTTCTAACCACAATTTTACAGAACTTTAACCTGAAATCT
GTTGATGATTTAAAGAACCTCAATACTACTGCAGTTACCAAAGGGATTGTTTCTCTGCCA
CCCTCATACCAGATCTGCTTCATCCCTGTCTGA
Chromosome Location
10
Locus
10q23.33
External Identifiers
ResourceLink
UniProtKB IDP10632
UniProtKB Entry NameCP2C8_HUMAN
GenBank Gene IDM17397
GenAtlas IDCYP2C8
HGNC IDHGNC:2622
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03796Palmitic Acidapproved, experimentalunknownDetails
DB00214TorasemideapprovedunknownsubstrateDetails
DB00252Phenytoinapproved, vet_approvedunknownsubstrateinducerDetails
DB00412Rosiglitazoneapproved, investigationalunknownsubstrateinhibitorDetails
DB00439Cerivastatinapproved, withdrawnunknownsubstrateinhibitorDetails
DB00564Carbamazepineapproved, investigationalunknownsubstrateinducerDetails
DB00682WarfarinapprovedunknownsubstrateinhibitorDetails
DB00755Tretinoinapproved, investigational, nutraceuticalunknownsubstrateDetails
DB00912Repaglinideapproved, investigationalunknownsubstrateDetails
DB01118Amiodaroneapproved, investigationalunknownsubstrateDetails
DB01132Pioglitazoneapproved, investigationalunknownsubstrateinhibitorDetails
DB01198ZopicloneapprovedunknownsubstrateDetails
DB01229Paclitaxelapproved, vet_approvedunknownsubstrateDetails
DB01261Sitagliptinapproved, investigationalunknownsubstrateDetails
DB01259Lapatinibapproved, investigationalunknownsubstrateinhibitorDetails
DB00227Lovastatinapproved, investigationalunknowninhibitorDetails
DB00440Trimethoprimapproved, vet_approvedunknownsubstrateinhibitorDetails
DB00471MontelukastapprovedunknowninhibitorDetails
DB00549Zafirlukastapproved, investigationalunknownsubstrateinhibitorDetails
DB00586Diclofenacapproved, vet_approvedunknownsubstrateDetails
DB00613Amodiaquineapproved, investigationalunknownsubstrateinhibitorDetails
DB00622Nicardipineapproved, investigationalunknownsubstrateinhibitorDetails
DB00641SimvastatinapprovedunknownsubstrateinhibitorDetails
DB01026Ketoconazoleapproved, investigationalunknowninhibitorDetails
DB01045RifampicinapprovedunknownsubstrateinducerDetails
DB01124Tolbutamideapproved, investigationalunknownsubstrateDetails
DB01241GemfibrozilapprovedunknowninhibitorinducerDetails
DB01424Aminophenazoneapproved, withdrawnunknownsubstrateDetails
DB01095FluvastatinapprovedunknownsubstrateinhibitorDetails
DB01023Felodipineapproved, investigationalunknowninhibitorDetails
DB00197Troglitazoneinvestigational, withdrawnunknownsubstrateinhibitorDetails
DB00796Candesartan cilexetilapprovedunknowninhibitorDetails
DB00257Clotrimazoleapproved, vet_approvedunknowninhibitorDetails
DB00764Mometasoneapproved, vet_approvedunknowninhibitorDetails
DB00938SalmeterolapprovedunknowninhibitorDetails
DB00481Raloxifeneapproved, investigationalunknowninhibitorDetails
DB01039FenofibrateapprovedunknowninhibitorDetails
DB00503Ritonavirapproved, investigationalunknowninhibitorinducerDetails
DB00451LevothyroxineapprovedunknowninhibitorDetails
DB00675TamoxifenapprovedunknowninhibitorDetails
DB00455Loratadineapproved, investigationalunknownsubstrateinhibitorDetails
DB04216Quercetinexperimental, investigationalunknowninhibitorDetails
DB01062Oxybutyninapproved, investigationalunknowninhibitorDetails
DB00603Medroxyprogesterone acetateapproved, investigationalunknowninhibitorDetails
DB00977EthinylestradiolapprovedunknownsubstrateinhibitorDetails
DB00421SpironolactoneapprovedunknowninhibitorDetails
DB01029Irbesartanapproved, investigationalunknownsubstrateinhibitorDetails
DB01181IfosfamideapprovedunknownsubstrateinducerDetails
DB01115NifedipineapprovedunknowninhibitorDetails
DB00468QuinineapprovedunknownsubstrateinhibitorDetails
DB01435Antipyrineapproved, investigationalunknownsubstrateDetails
DB00250Dapsoneapproved, investigationalunknownsubstrateDetails
DB00946Phenprocoumonapproved, investigationalunknownsubstrateDetails
DB00857Terbinafineapproved, investigational, vet_approvedunknownsubstrateDetails
DB00972AzelastineapprovedunknownsubstrateDetails
DB00398Sorafenibapproved, investigationalunknownsubstrateinhibitorDetails
DB01174Phenobarbitalapproved, investigationalunknowninducerDetails
DB00794Primidoneapproved, vet_approvedunknowninducerDetails
DB01201Rifapentineapproved, investigationalunknowninducerDetails
DB00418Secobarbitalapproved, vet_approvedunknowninducerDetails
DB06210EltrombopagapprovedunknownsubstrateinhibitorDetails
DB00678LosartanapprovedunknownsubstrateinhibitorDetails
DB04868Nilotinibapproved, investigationalunknowninhibitorinducerDetails
DB00661VerapamilapprovedunknownsubstrateDetails
DB01050IbuprofenapprovedunknownsubstrateDetails
DB00788Naproxenapproved, vet_approvedunknownsubstrateDetails
DB00921Buprenorphineapproved, illicit, investigational, vet_approvedunknownsubstrateDetails
DB00333MethadoneapprovedunknownsubstrateDetails
DB00201CaffeineapprovedunknownsubstrateDetails
DB04725LicofeloneinvestigationalunknownsubstrateinhibitorDetails
DB06739SeratrodastapprovedunknownsubstrateDetails
DB00402Eszopicloneapproved, investigationalunknownsubstrateDetails
DB08607(5R)-5-(4-{[(2R)-6-HYDROXY-2,5,7,8-TETRAMETHYL-3,4-DIHYDRO-2H-CHROMEN-2-YL]METHOXY}BENZYL)-1,3-THIAZOLIDINE-2,4-DIONEexperimentalunknownDetails
DB06772CabazitaxelapprovedunknownsubstrateDetails
DB01583LiotrixapprovedunknowninhibitorDetails
DB00945Acetylsalicylic acidapproved, vet_approvedunknownsubstrateDetails
DB00321AmitriptylineapprovedunknownsubstrateinhibitorDetails
DB00381AmlodipineapprovedunknowninhibitorDetails
DB00701Amprenavirapproved, investigationalunknownsubstrateDetails
DB01076AtorvastatinapprovedunknownsubstrateinhibitorDetails
DB01393Bezafibrateapproved, investigationalunknowninhibitorDetails
DB00835BrompheniramineapprovedunknownsubstrateDetails
DB01156BupropionapprovedunknownsubstrateDetails
DB00748CarbinoxamineapprovedunknownsubstrateDetails
DB00446Chloramphenicolapproved, vet_approvedunknowninhibitorDetails
DB00608Chloroquineapproved, investigational, vet_approvedunknownsubstrateDetails
DB00091Cyclosporineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00501Cimetidineapproved, investigationalunknowninhibitorDetails
DB00604Cisaprideapproved, investigational, withdrawnunknownsubstrateDetails
DB00758ClopidogrelapprovedunknowninhibitorDetails
DB00363ClozapineapprovedunknownsubstrateDetails
DB00907Cocaineapproved, illicitunknowninhibitorDetails
DB01394ColchicineapprovedunknowninhibitorinducerDetails
DB00169Cholecalciferolapproved, nutraceuticalunknowninhibitorDetails
DB00531Cyclophosphamideapproved, investigationalunknownsubstrateinducerDetails
DB00705DelavirdineapprovedunknowninhibitorDetails
DB01234Dexamethasoneapproved, investigational, vet_approvedunknowninducerDetails
DB00514DextromethorphanapprovedunknownsubstrateDetails
DB00647Dextropropoxypheneapproved, illicit, investigational, withdrawnunknowninhibitorDetails
DB00829Diazepamapproved, illicit, investigational, vet_approvedunknownsubstrateDetails
DB00343Diltiazemapproved, investigationalunknownsubstrateDetails
DB01184Domperidoneapproved, investigational, vet_approvedunknownsubstrateDetails
DB00783Estradiolapproved, investigational, vet_approvedunknownsubstrateDetails
DB00773EtoposideapprovedunknowninhibitorDetails
DB00544FluorouracilapprovedunknownsubstrateDetails
DB01218HalofantrineapprovedunknownsubstrateDetails
DB00741Hydrocortisoneapproved, vet_approvedunknowninducerDetails
DB00951Isoniazidapproved, investigationalunknowninhibitorDetails
DB01221Ketamineapproved, vet_approvedunknownsubstrateDetails
DB06738Ketobemidoneapproved, investigationalunknownsubstrateDetails
DB01009Ketoprofenapproved, vet_approvedunknowninhibitorDetails
DB00448Lansoprazoleapproved, investigationalunknownsubstrateDetails
DB00281Lidocaineapproved, vet_approvedunknownsubstrateDetails
DB00784Mefenamic acidapprovedunknownsubstrateinhibitorDetails
DB00814Meloxicamapproved, vet_approvedunknownsubstrateinhibitorDetails
DB00532Mephenytoinapproved, investigational, withdrawnunknownsubstrateDetails
DB00916MetronidazoleapprovedunknowninhibitorDetails
DB00370MirtazapineapprovedunknownsubstrateDetails
DB00295Morphineapproved, investigationalunknownsubstrateDetails
DB01183Naloxoneapproved, vet_approvedunknownsubstrateDetails
DB00184NicotineapprovedunknownsubstrateDetails
DB00665Nilutamideapproved, investigationalunknowninhibitorDetails
DB06712Nilvadipineapproved, investigationalunknowninhibitorDetails
DB00338Omeprazoleapproved, investigational, vet_approvedunknownsubstrateDetails
DB00316AcetaminophenapprovedunknownsubstrateDetails
DB00715Paroxetineapproved, investigationalunknowninhibitorDetails
DB00738Pentamidineapproved, investigationalunknownsubstrateDetails
DB00850PerphenazineapprovedunknownsubstrateDetails
DB00780PhenelzineapprovedunknowninhibitorDetails
DB00554Piroxicamapproved, investigationalunknownsubstrateinhibitorDetails
DB00175PravastatinapprovedunknowninhibitorDetails
DB01032Probenecidapproved, investigationalunknowninducerDetails
DB00396Progesteroneapproved, vet_approvedunknownsubstrateDetails
DB01182PropafenoneapprovedunknowninhibitorDetails
DB00818Propofolapproved, investigational, vet_approvedunknownsubstrateDetails
DB00205Pyrimethamineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00533Rofecoxibapproved, investigational, withdrawnunknowninhibitorDetails
DB01698Rutinapproved, experimental, investigationalunknowninhibitorDetails
DB01232Saquinavirapproved, investigationalunknowninhibitorDetails
DB01037Selegilineapproved, investigational, vet_approvedunknownsubstrateDetails
DB00359Sulfadiazineapproved, investigational, vet_approvedunknownsubstrateDetails
DB01015SulfamethoxazoleapprovedunknowninhibitorDetails
DB06729SulfaphenazoleapprovedunknowninhibitorDetails
DB01138SulfinpyrazoneapprovedunknowninhibitorDetails
DB00799Tazaroteneapproved, investigationalunknownsubstrateDetails
DB01079Tegaserodapproved, investigational, withdrawnunknowninhibitorDetails
DB00231Temazepamapproved, investigationalunknownsubstrateDetails
DB00342Terfenadineapproved, withdrawnunknowninhibitorDetails
DB00624Testosteroneapproved, investigationalunknownsubstrateDetails
DB00277TheophyllineapprovedunknownsubstrateDetails
DB00679Thioridazineapproved, withdrawnunknowninhibitorDetails
DB00208TiclopidineapprovedunknowninhibitorDetails
DB01007TioconazoleapprovedunknowninhibitorDetails
DB00897Triazolamapproved, investigationalunknowninhibitorDetails
DB00347TrimethadioneapprovedunknownsubstrateDetails
DB13179TroleandomycinapprovedunknowninhibitorDetails
DB00313Valproic Acidapproved, investigationalunknowninhibitorDetails
DB00495ZidovudineapprovedunknownsubstrateDetails
DB00530Erlotinibapproved, investigationalunknownsubstrateinhibitorDetails
DB00617ParamethadioneapprovedunknownsubstrateDetails
DB06589PazopanibapprovedunknownsubstrateinhibitorDetails
DB00255Diethylstilbestrolapproved, investigationalunknownsubstrateinhibitorDetails
DB00836LoperamideapprovedunknownsubstrateDetails
DB00918Almotriptanapproved, investigationalunknownsubstrateDetails
DB05229BeraprostinvestigationalunknownsubstrateDetails
DB06510MuraglitazarinvestigationalunknownsubstrateDetails
DB06770Benzyl alcoholapprovedunknownsubstrateDetails
DB08860PitavastatinapprovedunknownsubstrateDetails
DB05812AbirateroneapprovedunknowninhibitorDetails
DB06605ApixabanapprovedunknownsubstrateDetails
DB08828Vismodegibapproved, investigationalunknowninhibitorDetails
DB08896RegorafenibapprovedunknowninhibitorDetails
DB08899EnzalutamideapprovedunknownsubstrateinhibitorDetails
DB08901Ponatinibapproved, investigationalunknownsubstrateinhibitorDetails
DB08911TrametinibapprovedunknowninhibitorDetails
DB08912Dabrafenibapproved, investigationalunknownsubstrateinhibitorDetails
DB00688Mycophenolate mofetilapproved, investigationalunknownsubstrateDetails
DB08918Levomilnacipranapproved, investigationalunknownsubstrateDetails
DB00951Isoniazidapproved, investigationalunknownDetails
DB09080OlodaterolapprovednosubstrateDetails
DB09054IdelalisibapprovednoinhibitorDetails
DB09068Vortioxetineapproved, investigationalnosubstrateDetails
DB09280LumacaftorapprovednoinhibitorinducerDetails
DB09570Ixazomibapproved, investigationalunknownsubstrateDetails
DB11362SelexipagapprovednosubstrateDetails
DB08931RiociguatapprovedunknownsubstrateDetails
DB09183DasabuvirapprovednosubstrateDetails
DB09296Ombitasvirapproved, investigationalnosubstrateDetails
DB01601LopinavirapprovedunknowninhibitorDetails
DB00482Celecoxibapproved, investigationalunknowninhibitorDetails
DB00625Efavirenzapproved, investigationalunknowninhibitorDetails
DB01129Rabeprazoleapproved, investigationalunknowninhibitorDetails
DB08880TeriflunomideapprovedunknowninhibitorDetails
DB05219Crisaboroleapproved, investigationalnoinhibitorDetails
DB06595Midostaurinapproved, investigationalunknowninhibitorinducerDetails
DB05015Belinostatapproved, investigationalunknowninhibitorDetails
DB11613Velpatasvirapproved, investigationalnosubstrateDetails
DB06670OdanacatibinvestigationalnosubstrateDetails
DB01685Topiroxostatapproved, investigationalunknowninhibitorDetails
DB08922PerospironeapprovedunknownsubstrateDetails
DB12026Voxilaprevirapproved, investigationalnosubstrateDetails
DB13874Enasidenibapproved, investigationalunknownsubstrateinhibitorDetails
DB13919CandesartanexperimentalunknowninhibitorDetails
DB12070Letermovirapproved, investigationalnoinhibitorDetails
DB12267Brigatinibapproved, investigationalnosubstrateDetails
DB12332Rucaparibapproved, investigationalunknowninhibitorDetails
DB13943Testosterone cypionateapprovedunknownsubstrateDetails
DB13944Testosterone enanthateapprovedunknownsubstrateDetails
DB13946Testosterone undecanoateapproved, investigationalunknownsubstrateDetails
DB13952Estradiol acetateapproved, investigational, vet_approvedunknownsubstrateDetails
DB13953Estradiol benzoateapproved, investigational, vet_approvedunknownsubstrateDetails
DB13954Estradiol cypionateapproved, investigational, vet_approvedunknownsubstrateDetails
DB13955Estradiol dienanthateapproved, investigational, vet_approvedunknownsubstrateDetails
DB13956Estradiol valerateapproved, investigational, vet_approvedunknownsubstrateDetails
DB11901Apalutamideapproved, investigationalunknownsubstrateDetails
DB11633Isavuconazoleapproved, investigationalunknowninhibitorinducerDetails
DB11632Opicaponeapproved, investigationalunknowninhibitorDetails
DB13746Bioallethrinapproved, experimentalnosubstrateDetails
DB00486Nabiloneapproved, investigationalnoinhibitorDetails
DB11995Avatrombopagapproved, investigationalunknowninducerDetails
DB00176Fluvoxamineapproved, investigationalunknowninhibitorDetails
DB00973EzetimibeapprovedunknownDetails
DB14512Mometasone furoateapproved, vet_approvedunknownDetails
DB14538Hydrocortisone aceponateexperimental, vet_approvedunknowninducerDetails
DB14539Hydrocortisone acetateapproved, vet_approvedunknowninducerDetails
DB14540Hydrocortisone butyrateapproved, vet_approvedunknowninducerDetails
DB14541Hydrocortisone cypionateapproved, investigational, vet_approvedunknowninducerDetails
DB14542Hydrocortisone phosphateapproved, vet_approvedunknowninducerDetails
DB14543Hydrocortisone probutateapproved, vet_approvedunknowninducerDetails
DB14544Hydrocortisone valerateapproved, vet_approvedunknowninducerDetails
DB14568Ivosidenibapproved, investigationalunknowninducerDetails
DB14545Hydrocortisone succinateapprovedunknowninducerDetails
DB11979Elagolixapproved, investigationalyessubstrateDetails
DB13867Fluticasoneapproved, experimental, investigationalnoinhibitorDetails
DB08906Fluticasone furoateapprovednoinhibitorDetails
DB00588Fluticasone propionateapprovednoinhibitorDetails
DB00615Rifabutinapproved, investigationalnoinducerDetails
DB11753RifamycininvestigationalnoinducerDetails
DB01220Rifaximinapproved, investigationalnoinducerDetails
DB12781BalaglitazoneinvestigationalnosubstrateDetails
DB09201CiglitazoneexperimentalnosubstrateDetails
DB09198Lobeglitazoneapproved, investigationalnosubstrateDetails
DB09199NetoglitazoneexperimentalnosubstrateDetails
DB09200Rivoglitazoneexperimental, investigationalnosubstrateDetails
DB06616BosutinibapprovedunknowninhibitorDetails
DB08875Cabozantinibapproved, investigationalunknowninhibitorDetails
DB01645GenisteininvestigationalunknowninhibitorDetails
DB09078Lenvatinibapproved, investigationalunknowninhibitorDetails
DB01072Atazanavirapproved, investigationalunknowninhibitorDetails
DB08496(R)-warfarinexperimentalunknownsubstrateDetails
DB14055(S)-Warfarinexperimental, investigationalunknownsubstrateDetails
DB09256Tegafurapproved, investigationalunknownsubstrateDetails
DB00307Bexaroteneapproved, investigationalnoinhibitorDetails
DB01357MestranolapprovednosubstrateDetails
DB01609Deferasiroxapproved, investigationalunknowninhibitorDetails
DB00908Quinidineapproved, investigationalnoinhibitorDetails
DB00834Mifepristoneapproved, investigationalunknowninhibitorDetails
DB08881VemurafenibapprovedunknowninhibitorDetails