Cytochrome P450 2A6

Details

Name
Cytochrome P450 2A6
Synonyms
  • 1,4-cineole 2-exo-monooxygenase
  • 1.14.13.-
  • Coumarin 7-hydroxylase
  • CYP2A3
  • CYPIIA6
  • Cytochrome P450 IIA3
  • Cytochrome P450(I)
Gene Name
CYP2A6
Organism
Human
Amino acid sequence
>lcl|BSEQ0037226|Cytochrome P450 2A6
MLASGMLLVALLVCLTVMVLMSVWQQRKSKGKLPPGPTPLPFIGNYLQLNTEQMYNSLMK
ISERYGPVFTIHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVVFSN
GERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIDALRGTGGANIDPTFFLSRTVSN
VISSIVFGDRFDYKDKEFLSLLRMMLGIFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFQL
LQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFI
GGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYMEAVIHEIQ
RFGDVIPMSLARRVKKDTKFRDFFLPKGTEVFPMLGSVLRDPSFFSNPQDFNPQHFLNEK
GQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVGF
ATIPRNYTMSFLPR
Number of residues
494
Molecular Weight
56501.005
Theoretical pI
9.69
GO Classification
Functions
iron ion binding / heme binding / oxygen binding / oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen / arachidonic acid epoxygenase activity / enzyme binding / steroid hydroxylase activity / coumarin 7-hydroxylase activity
Processes
xenobiotic metabolic process / drug metabolic process / epoxygenase P450 pathway / exogenous drug catabolic process / small molecule metabolic process / coumarin metabolic process / coumarin catabolic process / oxidation-reduction process / steroid metabolic process
Components
cytoplasm / cytoplasmic microtubule / endoplasmic reticulum membrane / intracellular membrane-bounded organelle
General Function
Steroid hydroxylase activity
Specific Function
Exhibits a high coumarin 7-hydroxylase activity. Can act in the hydroxylation of the anti-cancer drugs cyclophosphamide and ifosphamide. Competent in the metabolic activation of aflatoxin B1. Constitutes the major nicotine C-oxidase. Acts as a 1,4-cineole 2-exo-monooxygenase. Possesses low phenacetin O-deethylation activity.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Endoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0021356|Cytochrome P450 2A6 (CYP2A6)
ATGCTGGCCTCAGGGATGCTTCTGGTGGCCTTGCTGGTCTGCCTGACTGTAATGGTCTTG
ATGTCTGTTTGGCAGCAGAGGAAGAGCAAGGGGAAGCTGCCTCCGGGACCCACCCCATTG
CCCTTCATTGGAAACTACCTGCAGCTGAACACAGAGCAGATGTACAACTCCCTCATGAAG
ATCAGTGAGCGCTATGGCCCCGTGTTCACCATTCACTTGGGGCCCCGGCGGGTCGTGGTG
CTGTGTGGACATGATGCCGTCAGGGAGGCTCTGGTGGACCAGGCTGAGGAGTTCAGCGGG
CGAGGCGAGCAAGCCACCTTCGACTGGGTCTTCAAAGGCTATGGCGTGGTATTCAGCAAC
GGGGAGCGCGCCAAGCAGCTCCGGCGCTTCTCCATCGCCACCCTGCGGGACTTCGGGGTG
GGCAAGCGAGGCATCGAGGAGCGCATCCAGGAGGAGGCGGGCTTCCTCATCGACGCCCTC
CGGGGCACTGGCGGCGCCAATATCGATCCCACCTTCTTCCTGAGCCGCACAGTCTCCAAT
GTCATCAGCTCCATTGTCTTTGGGGACCGCTTTGACTATAAGGACAAAGAGTTCCTGTCA
CTGTTGCGCATGATGCTAGGAATCTTCCAGTTCACGTCAACCTCCACGGGGCAGCTCTAT
GAGATGTTCTCTTCGGTGATGAAACACCTGCCAGGACCACAGCAACAGGCCTTTCAGTTG
CTGCAAGGGCTGGAGGACTTCATAGCCAAGAAGGTGGAGCACAACCAGCGCACGCTGGAT
CCCAATTCCCCACGGGACTTCATTGACTCCTTTCTCATCCGCATGCAGGAGGAGGAGAAG
AACCCCAACACGGAGTTCTACTTGAAAAACCTGGTGATGACCACGTTGAACCTCTTCATT
GGGGGCACCGAGACCGTCAGCACCACCCTGCGCTATGGCTTCTTGCTGCTCATGAAGCAC
CCAGAGGTGGAGGCCAAGGTCCATGAGGAGATTGACAGAGTGATCGGCAAGAACCGGCAG
CCCAAGTTTGAGGACCGGGCCAAGATGCCCTACATGGAGGCAGTGATCCACGAGATCCAA
AGATTTGGAGACGTGATCCCCATGAGTTTGGCCCGCAGAGTCAAAAAGGACACCAAGTTT
CGGGATTTCTTCCTCCCTAAGGGCACCGAAGTGTACCCTATGCTGGGCTCTGTGCTGAGA
GACCCCAGTTTCTTCTCCAACCCCCAGGACTTCAATCCCCAGCACTTCCTGAATGAGAAG
GGGCAGTTTAAGAAGAGTGATGCTTTTGTGCCCTTTTCCATCGGAAAGCGGAACTGTTTC
GGAGAAGGCCTGGCCAGAATGGAGCTCTTTCTCTTCTTCACCACCGTCATGCAGAACTTC
CGCCTCAAGTCCTCCCAGTCACCTAAGGACATTGACGTGTCCCCCAAACACGTGGGCTTT
GCCACGATCCCACGAAACTACACCATGAGCTTCCTGCCCCGCTGA
Chromosome Location
19
Locus
19q13.2
External Identifiers
ResourceLink
UniProtKB IDP11509
UniProtKB Entry NameCP2A6_HUMAN
GenBank Gene IDX13897
GenAtlas IDCYP2A6
HGNC IDHGNC:2610
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04665CoumarinexperimentalunknownDetails
DB00184NicotineapprovedunknownsubstrateinhibitorDetails
DB00983Formoterolapproved, investigationalunknownsubstrateDetails
DB01006Letrozoleapproved, investigationalunknownsubstrateinhibitorDetails
DB00255Diethylstilbestrolapproved, investigationalunknowninhibitorDetails
DB00356ChlorzoxazoneapprovedunknownsubstrateDetails
DB00553MethoxsalenapprovedunknownsubstrateinhibitorDetails
DB00752Tranylcypromineapproved, investigationalunknowninhibitorDetails
DB01011Metyraponeapproved, investigationalunknowninhibitorDetails
DB01085Pilocarpineapproved, investigationalunknownsubstrateinhibitorDetails
DB01159Halothaneapproved, vet_approvedunknownsubstrateDetails
DB04977PlitidepsininvestigationalunknownDetails
DB01115NifedipineapprovedunknownsubstrateDetails
DB01037Selegilineapproved, investigational, vet_approvedunknownsubstrateDetails
DB01181IfosfamideapprovedunknownsubstrateDetails
DB00313Valproic Acidapproved, investigationalunknownsubstrateinducerDetails
DB00238NevirapineapprovedunknownsubstrateDetails
DB00568Cinnarizineapproved, investigationalunknownsubstrateDetails
DB04841FlunarizineapprovedunknownsubstrateDetails
DB00471MontelukastapprovedunknownsubstrateDetails
DB07609N,N-DIMETHYL(5-(PYRIDIN-3-YL)FURAN-2-YL)METHANAMINEexperimentalunknownDetails
DB07617N-METHYL(5-(PYRIDIN-3-YL)FURAN-2-YL)METHANAMINEexperimentalunknownDetails
DB07621(5-(PYRIDIN-3-YL)FURAN-2-YL)METHANAMINEexperimentalunknownDetails
DB076234,4'-DIPYRIDYL DISULFIDEexperimentalunknownDetails
DB00182Amphetamineapproved, illicit, investigationalunknowninhibitorDetails
DB00381AmlodipineapprovedunknowninhibitorDetails
DB01351Amobarbitalapproved, illicitunknowninducerDetails
DB00972AzelastineapprovedunknowninhibitorDetails
DB00207AzithromycinapprovedunknowninhibitorDetails
DB00921Buprenorphineapproved, illicit, investigational, vet_approvedunknowninhibitorDetails
DB01156BupropionapprovedunknownsubstrateDetails
DB00604Cisaprideapproved, investigational, withdrawnunknownsubstrateDetails
DB00636Clofibrateapproved, investigationalunknowninhibitorDetails
DB06470clomethiazoleinvestigationalunknownsubstrateDetails
DB00882Clomifeneapproved, investigationalunknowninhibitorDetails
DB00257Clotrimazoleapproved, vet_approvedunknowninhibitorDetails
DB00363ClozapineapprovedunknownsubstrateDetails
DB00531Cyclophosphamideapproved, investigationalunknownsubstrateDetails
DB01151Desipramineapproved, investigationalunknowninhibitorDetails
DB01234Dexamethasoneapproved, investigational, vet_approvedunknowninducerDetails
DB01191Dexfenfluramineapproved, illicit, investigational, withdrawnunknowninhibitorDetails
DB00470Dronabinolapproved, illicitunknownsubstrateDetails
DB00216Eletriptanapproved, investigationalunknowninducerDetails
DB01544Flunitrazepamapproved, illicitunknownsubstrateDetails
DB00544FluorouracilapprovedunknownsubstrateDetails
DB01213Fomepizoleapproved, vet_approvedunknowninhibitorDetails
DB00951Isoniazidapproved, investigationalunknowninhibitorDetails
DB01026Ketoconazoleapproved, investigationalunknowninhibitorDetails
DB00281Lidocaineapproved, vet_approvedunknownsubstrateDetails
DB01043Memantineapproved, investigationalunknowninhibitorDetails
DB00170Menadioneapproved, nutraceuticalunknowninhibitorDetails
DB01028Methoxyfluraneapproved, investigational, vet_approvedunknownsubstrateDetails
DB01110Miconazoleapproved, investigational, vet_approvedunknowninhibitorDetails
DB06712Nilvadipineapproved, investigationalunknowninhibitorDetails
DB01059NorfloxacinapprovedunknowninhibitorDetails
DB00316AcetaminophenapprovedunknownsubstrateDetails
DB03783PhenacetinwithdrawnunknownsubstrateDetails
DB01435Antipyrineapproved, investigationalunknownsubstrateDetails
DB01174Phenobarbitalapproved, investigationalunknowninhibitorinducerDetails
DB00860Prednisoloneapproved, vet_approvedunknowninhibitorDetails
DB00396Progesteroneapproved, vet_approvedunknownsubstrateDetails
DB00818Propofolapproved, investigational, vet_approvedunknownsubstrateDetails
DB01045RifampicinapprovedunknownsubstrateinhibitorinducerDetails
DB00412Rosiglitazoneapproved, investigationalunknowninhibitorDetails
DB06739SeratrodastapprovedunknowninhibitorDetails
DB01236Sevofluraneapproved, vet_approvedunknownsubstrateDetails
DB06729SulfaphenazoleapprovedunknowninhibitorDetails
DB00675TamoxifenapprovedunknownsubstrateDetails
DB00763MethimazoleapprovedunknowninhibitorDetails
DB13179TroleandomycinapprovedunknowninhibitorDetails
DB00495ZidovudineapprovedunknownsubstrateDetails
DB00690Flurazepamapproved, illicit, investigationalunknownsubstrateDetails
DB00755Tretinoinapproved, investigational, nutraceuticalunknownsubstrateDetails
DB01274Arformoterolapproved, investigationalunknownsubstrateDetails
DB04871LorcaserinapprovednosubstrateDetails
DB04953Ezogabineapproved, investigationalunknowninhibitorDetails
DB01118Amiodaroneapproved, investigationalunknowninhibitorDetails
DB00312Pentobarbitalapproved, investigational, vet_approvedunknowninducerDetails
DB06292DapagliflozinapprovednosubstrateDetails
DB09068Vortioxetineapproved, investigationalnosubstrateDetails
DB09256Tegafurapproved, investigationalyessubstrateDetails