Aromatase

Details

Name
Aromatase
Synonyms
  • 1.14.14.14
  • ARO1
  • CYAR
  • CYP19
  • CYPXIX
  • Cytochrome P-450AROM
  • Cytochrome P450 19A1
  • Estrogen synthase
Gene Name
CYP19A1
Organism
Human
Amino acid sequence
>lcl|BSEQ0004098|Aromatase
MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLI
SHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL
GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN
ESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWL
YKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCI
LEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFI
YESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK
NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLH
PDETKNMLEMIFTPRNSDRCLEH
Number of residues
503
Molecular Weight
57882.48
Theoretical pI
7.56
GO Classification
Functions
iron ion binding / heme binding / oxygen binding / aromatase activity / oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen / electron carrier activity
Processes
xenobiotic metabolic process / estrogen biosynthetic process / prostate gland growth / sterol metabolic process / androgen metabolic process / negative regulation of macrophage chemotaxis / negative regulation of chronic inflammatory response / small molecule metabolic process / steroid biosynthetic process / steroid metabolic process
Components
membrane / endoplasmic reticulum / endoplasmic reticulum membrane
General Function
Oxygen binding
Specific Function
Catalyzes the formation of aromatic C18 estrogens from C19 androgens.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0016675|Aromatase (CYP19A1)
ATGGTTTTGGAAATGCTGAACCCGATACATTATAACATCACCAGCATCGTGCCTGAAGCC
ATGCCTGCTGCCACCATGCCAGTCCTGCTCCTCACTGGCCTTTTTCTCTTGGTGTGGAAT
TATGAGGGCACATCCTCAATACCAGGTCCTGGCTACTGCATGGGAATTGGACCCCTCATC
TCCCACGGCAGATTCCTGTGGATGGGGATCGGCAGTGCCTGCAACTACTACAACCGGGTA
TATGGAGAATTCATGCGAGTCTGGATCTCTGGAGAGGAAACACTCATTATCAGCAAGTCC
TCAAGTATGTTCCACATAATGAAGCACAATCATTACAGCTCTCGATTCGGCAGCAAACTT
GGGCTGCAGTGCATCGGTATGCATGAGAAAGGCATCATATTTAACAACAATCCAGAGCTC
TGGAAAACAACTCGACCCTTCTTTATGAAAGCTCTGTCAGGCCCCGGCCTTGTTCGTATG
GTCACAGTCTGTGCTGAATCCCTCAAAACACATCTGGACAGGTTGGAGGAGGTGACCAAT
GAATCGGGCTATGTGGACGTGTTGACCCTTCTGCGTCGTGTCATGCTGGACACCTCTAAC
ACGCTCTTCTTGAGGATCCCTTTGGACGAAAGTGCTATCGTGGTTAAAATCCAAGGTTAT
TTTGATGCATGGCAAGCTCTCCTCATCAAACCAGACATCTTCTTTAAGATTTCTTGGCTA
TACAAAAAGTATGAGAAGTCTGTCAAGGATTTGAAAGATGCCATAGAAGTTCTGATAGCA
GAAAAAAGACGCAGGATTTCCACAGAAGAGAAACTGGAAGAATGTATGGACTTTGCCACT
GAGTTGATTTTAGCAGAGAAACGTGGTGACCTGACAAGAGAGAATGTGAACCAGTGCATA
TTGGAAATGCTGATCGCAGCTCCTGACACCATGTCTGTCTCTTTGTTCTTCATGCTATTT
CTCATTGCAAAGCACCCTAATGTTGAAGAGGCAATAATAAAGGAAATCCAGACTGTTATT
GGTGAGAGAGACATAAAGATTGATGATATACAAAAATTAAAAGTGATGGAAAACTTCATT
TATGAGAGCATGCGGTACCAGCCTGTCGTGGACTTGGTCATGCGCAAAGCCTTAGAAGAT
GATGTAATCGATGGCTACCCAGTGAAAAAGGGGACAAACATTATCCTGAATATTGGAAGG
ATGCACAGACTCGAGTTTTTCCCCAAACCCAATGAATTTACTCTTGAAAATTTTGCAAAG
AATGTTCCTTATAGGTACTTTCAGCCATTTGGCTTTGGGCCCCGTGGCTGTGCAGGAAAG
TACATCGCCATGGTGATGATGAAAGCCATCCTCGTTACACTTCTGAGACGATTCCACGTG
AAGACATTGCAAGGACAGTGTGTTGAGAGCATACAGAAGATACACGACTTGTCCTTGCAC
CCAGATGAGACTAAAAACATGCTGGAAATGATCTTTACCCCAAGAAACTCAGACAGGTGT
CTGGAACACTAG
Chromosome Location
15
Locus
15q21.1
External Identifiers
ResourceLink
UniProtKB IDP11511
UniProtKB Entry NameCP19A_HUMAN
GenBank Protein ID179002
GenBank Gene IDM22246
GenAtlas IDCYP19A1
HGNC IDHGNC:2594
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00357Aminoglutethimideapproved, investigationalyesinhibitorDetails
DB01217Anastrozoleapproved, investigationalyesinhibitorDetails
DB00990Exemestaneapproved, investigationalyesinhibitorDetails
DB01006Letrozoleapproved, investigationalyesantagonistDetails
DB00894Testolactoneapproved, investigationalyesinhibitorDetails
DB05749MPI-674investigationalunknownDetails
DB01217Anastrozoleapproved, investigationalunknowninhibitorDetails
DB01006Letrozoleapproved, investigationalunknownsubstrateinhibitorDetails
DB00255Diethylstilbestrolapproved, investigationalunknowninducerDetails
DB00624Testosteroneapproved, investigationalunknownsubstrateDetails
DB01406DanazolapprovedunknowninhibitorDetails
DB02901Stanoloneillicit, investigationalunknownsubstrateDetails
DB00443Betamethasoneapproved, vet_approvedunknownsubstrateinducerDetails
DB04794Bifonazoleapproved, investigationalunknowninhibitorDetails
DB06719Buserelinapproved, investigationalunknowninducerDetails
DB00882Clomifeneapproved, investigationalunknowninhibitorDetails
DB00257Clotrimazoleapproved, vet_approvedunknowninhibitorDetails
DB04839Cyproterone acetateapproved, investigationalunknowninhibitorDetails
DB01234Dexamethasoneapproved, investigational, vet_approvedunknowninducerDetails
DB00917DinoprostoneapprovedunknowninducerDetails
DB01127EconazoleapprovedunknowninhibitorDetails
DB00292EtomidateapprovedunknowninhibitorDetails
DB00926EtretinatewithdrawnunknowninhibitorDetails
DB00990Exemestaneapproved, investigationalunknowninhibitorDetails
DB01227Levomethadyl acetateapproved, investigationalunknownsubstrateDetails
DB00367Levonorgestrelapproved, investigationalunknowninhibitorDetails
DB00358Mefloquineapproved, investigationalunknowninhibitorDetails
DB01065Melatoninapproved, nutraceutical, vet_approvedunknowninhibitorDetails
DB00333MethadoneapprovedunknownsubstrateDetails
DB06710MethyltestosteroneapprovedunknowninducerDetails
DB00984Nandrolone phenpropionateapproved, illicit, investigationalunknownsubstrateDetails
DB01229Paclitaxelapproved, vet_approvedunknowninhibitorDetails
DB00481Raloxifeneapproved, investigationalunknowninhibitorDetails
DB00675TamoxifenapprovedunknowninhibitorDetails
DB00857Terbinafineapproved, investigational, vet_approvedunknowninhibitorDetails
DB01007TioconazoleapprovedunknowninhibitorDetails
DB00072Trastuzumabapproved, investigationalunknowninhibitorDetails
DB00197Troglitazoneinvestigational, withdrawnunknowninhibitorDetails
DB023422-MethoxyestradiolinvestigationalunknownDetails
DB00858DrostanoloneillicitunknowninhibitorDetails
DB00974Edetic Acidapproved, vet_approvedunknownsubstrateDetails
DB00389Carbimazoleapproved, investigationalunknowninhibitorDetails
DB00856Chlorphenesinapproved, experimentalunknowninducerDetails
DB00269Chlorotrianiseneinvestigational, withdrawnunknowninducerDetails
DB05804Prasterone sulfateinvestigationalunknowninducerDetails
DB08804Nandrolone decanoateapproved, illicitunknowninducerDetails
DB05875substance PinvestigationalunknowninhibitorDetails
DB06147Sulfathiazoleapproved, vet_approvedunknowninducerDetails
DB01026Ketoconazoleapproved, investigationalunknowninhibitorDetails
DB00184NicotineapprovedunknowninhibitorDetails
DB09389NorgestrelapprovedunknowninhibitorDetails
DB04539GlyphosateexperimentalunknownDetails
DB00655EstroneapprovedunknownDetails
DB03467NaringeninexperimentalunknowninhibitorDetails
DB13943Testosterone cypionateapprovedunknownsubstrateDetails
DB13944Testosterone enanthateapprovedunknownsubstrateDetails
DB13946Testosterone undecanoateapproved, investigationalunknownsubstrateDetails
DB13951Stanolone acetateexperimentalunknownsubstrateDetails
DB01110Miconazoleapproved, investigational, vet_approvedunknownDetails
DB14600Edetate disodium anhydrousapproved, vet_approvedunknownDetails