Cytochrome P450 2C9

Details

Name
Cytochrome P450 2C9
Synonyms
  • (R)-limonene 6-monooxygenase
  • (S)-limonene 6-monooxygenase
  • (S)-limonene 7-monooxygenase
  • 1.14.13.-
  • Cholesterol 25-hydroxylase
  • CYP2C10
  • CYPIIC9
  • Cytochrome P-450MP
  • Cytochrome P450 MP-4
  • Cytochrome P450 MP-8
  • Cytochrome P450 PB-1
  • S-mephenytoin 4-hydroxylase
Gene Name
CYP2C9
Organism
Human
Amino acid sequence
>lcl|BSEQ0005471|Cytochrome P450 2C9
MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKV
YGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKW
KEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICS
IIFHKRFDYKDQQFLNLMEKLNENIKILSSPWIQICNNFSPIIDYFPGTHNKLLKNVAFM
KSYILEKVKEHQESMDMNNPQDFIDCFLMKMEKEKHNQPSEFTIESLENTAVDLFGAGTE
TTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDAVVHEVQRYID
LLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSVLHDNKEFPNPEMFDPHHFLDEGGNFK
KSKYFMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVP
PFYQLCFIPV
Number of residues
490
Molecular Weight
55627.365
Theoretical pI
7.99
GO Classification
Functions
drug binding / oxidoreductase activity / iron ion binding / heme binding / arachidonic acid epoxygenase activity / monooxygenase activity / steroid hydroxylase activity / (R)-limonene 6-monooxygenase activity / oxygen binding / (S)-limonene 6-monooxygenase activity / aromatase activity / (S)-limonene 7-monooxygenase activity / oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen / caffeine oxidase activity
Processes
drug catabolic process / oxidation-reduction process / monoterpenoid metabolic process / steroid metabolic process / omega-hydroxylase P450 pathway / xenobiotic metabolic process / oxidative demethylation / arachidonic acid metabolic process / drug metabolic process / epoxygenase P450 pathway / exogenous drug catabolic process / monocarboxylic acid metabolic process / cellular amide metabolic process / small molecule metabolic process / urea metabolic process
Components
cytoplasm / endoplasmic reticulum membrane / intracellular membrane-bounded organelle
General Function
Steroid hydroxylase activity
Specific Function
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. This enzyme contributes to the wide pharmacokinetics variability of the metabolism of drugs such as S-warfarin, diclofenac, phenytoin, tolbutamide and losartan.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Endoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0016893|Cytochrome P450 2C9 (CYP2C9)
ATGGATTCTCTTGTGGTCCTTGTGCTCTGTCTCTCATGTTTGCTTCTCCTTTCACTCTGG
AGACAGAGCTCTGGGAGAGGAAAACTCCCTCCTGGCCCCACTCCTCTCCCAGTGATTGGA
AATATCCTACAGATAGGTATTAAGGACATCAGCAAATCCTTAACCAATCTCTCAAAGGTC
TATGGCCCTGTGTTCACTCTGTATTTTGGCCTGAAACCCATAGTGGTGCTGCATGGATAT
GAAGCAGTGAAGGAAGCCCTGATTGATCTTGGAGAGGAGTTTTCTGGAAGAGGCATTTTC
CCACTGGCTGAAAGAGCTAACAGAGGATTTGGAATTGTTTTCAGCAATGGAAAGAAATGG
AAGGAGATCCGGCGTTTCTCCCTCATGACGCTGCGGAATTTTGGGATGGGGAAGAGGAGC
ATTGAGGACCGTGTTCAAGAGGAAGCCCGCTGCCTTGTGGAGGAGTTGAGAAAAACCAAG
GCCTCACCCTGTGATCCCACTTTCATCCTGGGCTGTGCTCCCTGCAATGTGATCTGCTCC
ATTATTTTCCATAAACGTTTTGATTATAAAGATCAGCAATTTCTTAACTTAATGGAAAAG
TTGAATGAAAACATCAAGATTTTGAGCAGCCCCTGGATCCAGATCTGCAATAATTTTTCT
CCTATCATTGATTACTTCCCGGGAACTCACAACAAATTACTTAAAAACGTTGCTTTTATG
AAAAGTTATATTTTGGAAAAAGTAAAAGAACACCAAGAATCAATGGACATGAACAACCCT
CAGGACTTTATTGATTGCTTCCTGATGAAAATGGAGAAGGAAAAGCACAACCAACCATCT
GAATTTACTATTGAAAGCTTGGAAAACACTGCAGTTGACTTGTTTGGAGCTGGGACAGAG
ACGACAAGCACAACCCTGAGATATGCTCTCCTTCTCCTGCTGAAGCACCCAGAGGTCACA
GCTAAAGTCCAGGAAGAGATTGAACGTGTGATTGGCAGAAACCGGAGCCCCTGCATGCAA
GACAGGAGCCACATGCCCTACACAGATGCTGTGGTGCACGAGGTCCAGAGATACATTGAC
CTTCTCCCCACCAGCCTGCCCCATGCAGTGACCTGTGACATTAAATTCAGAAACTATCTC
ATTCCCAAGGGCACAACCATATTAATTTCCCTGACTTCTGTGCTACATGACAACAAAGAA
TTTCCCAACCCAGAGATGTTTGACCCTCATCACTTTCTGGATGAAGGTGGCAATTTTAAG
AAAAGTAAATACTTCATGCCTTTCTCAGCAGGAAAACGGATTTGTGTGGGAGAAGCCCTG
GCCGGCATGGAGCTGTTTTTATTCCTGACCTCCATTTTACAGAACTTTAACCTGAAATCT
CTGGTTGACCCAAAGAACCTTGACACCACTCCAGTTGTCAATGGATTTGCCTCTGTGCCG
CCCTTCTACCAGCTGTGCTTCATTCCTGTCTGA
Chromosome Location
10
Locus
10q24
External Identifiers
ResourceLink
UniProtKB IDP11712
UniProtKB Entry NameCP2C9_HUMAN
GenBank Gene IDAY341248
GenAtlas IDCYP2C9
HGNC IDHGNC:2623
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB025074-Hydroxy-3-[(1s)-3-Oxo-1-Phenylbutyl]-2h-Chromen-2-OneexperimentalunknownDetails
DB03317Heme CexperimentalunknownDetails
DB00196Fluconazoleapproved, investigationalunknowninhibitorDetails
DB00203Sildenafilapproved, investigationalunknownsubstrateinhibitorDetails
DB00222GlimepirideapprovedunknownsubstrateDetails
DB00250Dapsoneapproved, investigationalunknownsubstrateinducerDetails
DB00327Hydromorphoneapproved, illicitunknownsubstrateDetails
DB00469TenoxicamapprovedunknownsubstrateDetails
DB00470Dronabinolapproved, illicitunknownsubstrateDetails
DB00471MontelukastapprovedunknownsubstrateDetails
DB00472Fluoxetineapproved, vet_approvedunknownsubstrateinhibitorDetails
DB00482Celecoxibapproved, investigationalunknownsubstrateDetails
DB00549Zafirlukastapproved, investigationalunknownsubstrateinhibitorDetails
DB00559Bosentanapproved, investigationalunknownsubstrateinducerDetails
DB00580Valdecoxibapproved, investigational, withdrawnunknownsubstrateinhibitorDetails
DB00582Voriconazoleapproved, investigationalunknownsubstrateinhibitorDetails
DB00586Diclofenacapproved, vet_approvedunknownsubstrateinhibitorDetails
DB00617ParamethadioneapprovedunknownsubstrateDetails
DB00675TamoxifenapprovedunknownsubstrateinhibitorDetails
DB00678LosartanapprovedunknownsubstrateinhibitorDetails
DB00682WarfarinapprovedunknownsubstrateinhibitorDetails
DB00712Flurbiprofenapproved, investigationalunknownsubstrateDetails
DB00731Nateglinideapproved, investigationalunknownsubstrateDetails
DB00744Zileutonapproved, investigational, withdrawnunknownsubstrateDetails
DB00749Etodolacapproved, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB00784Mefenamic acidapprovedunknownsubstrateinhibitorDetails
DB00814Meloxicamapproved, vet_approvedunknownsubstrateinhibitorDetails
DB00870Suprofenapproved, withdrawnunknownsubstrateinhibitorDetails
DB00916MetronidazoleapprovedunknownsubstrateinhibitorDetails
DB00946Phenprocoumonapproved, investigationalunknownsubstrateDetails
DB00983Formoterolapproved, investigationalunknownsubstrateDetails
DB01015SulfamethoxazoleapprovedunknownsubstrateinhibitorDetails
DB01018Guanfacineapproved, investigationalunknownsubstrateDetails
DB01029Irbesartanapproved, investigationalunknownsubstrateinhibitorDetails
DB01050IbuprofenapprovedunknownsubstrateinhibitorDetails
DB01067Glipizideapproved, investigationalunknownsubstrateDetails
DB01095FluvastatinapprovedunknownsubstrateinhibitorinducerDetails
DB01104SertralineapprovedunknownsubstrateinhibitorDetails
DB01136Carvedilolapproved, investigationalunknownsubstrateDetails
DB01283Lumiracoxibapproved, investigationalunknownsubstrateDetails
DB00969Alosetronapproved, withdrawnunknownsubstrateDetails
DB00176Fluvoxamineapproved, investigationalunknowninhibitorDetails
DB00213PantoprazoleapprovedunknowninhibitorDetails
DB00214TorasemideapprovedunknownsubstrateDetails
DB00252Phenytoinapproved, vet_approvedunknownsubstrateinhibitorinducerDetails
DB00342Terfenadineapproved, withdrawnunknownsubstrateDetails
DB00412Rosiglitazoneapproved, investigationalunknownsubstrateinhibitorDetails
DB00448Lansoprazoleapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB00503Ritonavirapproved, investigationalunknowninhibitorinducerDetails
DB00532Mephenytoininvestigational, withdrawnunknownsubstrateDetails
DB00622Nicardipineapproved, investigationalunknowninhibitorinducerDetails
DB00673Aprepitantapproved, investigationalunknowninhibitorinducerDetails
DB00705DelavirdineapprovedunknowninhibitorDetails
DB00967Desloratadineapproved, investigationalunknowninhibitorDetails
DB01016GlyburideapprovedunknownsubstrateinhibitorDetails
DB01026Ketoconazoleapproved, investigationalunknowninhibitorDetails
DB01110Miconazoleapproved, investigational, vet_approvedunknowninhibitorDetails
DB01118Amiodaroneapproved, investigationalunknowninhibitorDetails
DB01124Tolbutamideapproved, investigationalunknownsubstrateDetails
DB01241GemfibrozilapprovedunknowninhibitorDetails
DB13179TroleandomycinapprovedunknownDetails
DB01381Ginkgo bilobaapproved, investigational, nutraceuticalunknowninhibitorDetails
DB01418Acenocoumarolapproved, investigationalunknownsubstrateinhibitorDetails
DB025074-Hydroxy-3-[(1s)-3-Oxo-1-Phenylbutyl]-2h-Chromen-2-OneexperimentalunknownDetails
DB04856DexloxiglumideinvestigationalunknownDetails
DB06442AvasimibeinvestigationalunknowninhibitorDetails
DB01098RosuvastatinapprovedunknownsubstrateinhibitorDetails
DB01065Melatoninapproved, nutraceutical, vet_approvedunknownsubstrateDetails
DB00796Candesartan cilexetilapprovedunknownsubstrateinhibitorDetails
DB00227Lovastatinapproved, investigationalunknowninhibitorinducerDetails
DB00641SimvastatinapprovedunknowninhibitorinducerDetails
DB01076AtorvastatinapprovedunknowninhibitorinducerDetails
DB00439Cerivastatinapproved, withdrawnunknowninhibitorinducerDetails
DB01072Atazanavirapproved, investigationalunknownsubstrateDetails
DB01181IfosfamideapprovedunknownsubstrateinducerDetails
DB00619ImatinibapprovedunknownsubstrateinhibitorDetails
DB00468QuinineapprovedunknownsubstrateinhibitorDetails
DB01142Doxepinapproved, investigationalunknownsubstrateDetails
DB00321AmitriptylineapprovedunknownsubstrateDetails
DB04557Arachidonic AcidexperimentalunknownsubstrateDetails
DB01045RifampicinapprovedunknownsubstrateinducerDetails
DB01174Phenobarbitalapproved, investigationalunknownsubstrateinducerDetails
DB01234Dexamethasoneapproved, investigational, vet_approvedunknowninducerDetails
DB00404Alprazolamapproved, illicit, investigationalunknownsubstrateDetails
DB00363ClozapineapprovedunknownsubstrateinhibitorDetails
DB00829Diazepamapproved, illicit, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB01357MestranolapprovedunknownsubstrateDetails
DB00788Naproxenapproved, vet_approvedunknownsubstrateDetails
DB00531Cyclophosphamideapproved, investigationalunknownsubstrateinducerDetails
DB01355HexobarbitalapprovedunknownsubstrateDetails
DB00396Progesteroneapproved, vet_approvedunknownsubstrateinhibitorDetails
DB00554Piroxicamapproved, investigationalunknownsubstrateinhibitorDetails
DB00208TiclopidineapprovedunknowninhibitorDetails
DB00338Omeprazoleapproved, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB00715Paroxetineapproved, investigationalunknowninhibitorDetails
DB01435Antipyrineapproved, investigationalunknownsubstrateDetails
DB00177Valsartanapproved, investigationalunknownsubstrateinhibitorDetails
DB00188Bortezomibapproved, investigationalnosubstrateinhibitorDetails
DB01041Thalidomideapproved, investigational, withdrawnunknownsubstrateDetails
DB05109Trabectedinapproved, investigationalunknownsubstrateDetails
DB00540NortriptylineapprovedunknownsubstrateDetails
DB00285VenlafaxineapprovedunknownsubstrateDetails
DB00313Valproic Acidapproved, investigationalunknownsubstrateinhibitorDetails
DB00857Terbinafineapproved, investigational, vet_approvedunknownsubstrateDetails
DB00238NevirapineapprovedunknownsubstrateinhibitorDetails
DB06652VicrivirocinvestigationalunknownsubstrateDetails
DB00972AzelastineapprovedunknownsubstrateinhibitorDetails
DB00568Cinnarizineapproved, investigationalunknownsubstrateDetails
DB04841FlunarizineapprovedunknownsubstrateDetails
DB01075Diphenhydramineapproved, investigationalunknownsubstrateDetails
DB06725Lornoxicamapproved, investigationalunknownsubstrateinhibitorDetails
DB01039FenofibrateapprovedunknowninhibitorDetails
DB00951Isoniazidapproved, investigationalunknowninhibitorDetails
DB00812Phenylbutazoneapproved, vet_approvedunknownsubstrateinhibitorDetails
DB01032Probenecidapproved, investigationalunknowninhibitorDetails
DB06729SulfaphenazoleapprovedunknowninhibitorDetails
DB00444TeniposideapprovedunknowninhibitorDetails
DB06414EtravirineapprovedunknownsubstrateinhibitorDetails
DB01320Fosphenytoinapproved, investigationalunknownsubstrateinducerDetails
DB01221Ketamineapproved, vet_approvedunknownsubstrateDetails
DB01229Paclitaxelapproved, vet_approvedunknownsubstrateDetails
DB00359Sulfadiazineapproved, investigational, vet_approvedunknowninhibitorDetails
DB01138SulfinpyrazoneapprovedunknownsubstrateinhibitorDetails
DB00263Sulfisoxazoleapproved, vet_approvedunknowninhibitorDetails
DB00440Trimethoprimapproved, vet_approvedunknownsubstrateinhibitorDetails
DB01198ZopicloneapprovedunknownsubstrateDetails
DB00564Carbamazepineapproved, investigationalunknowninducerDetails
DB00794Primidoneapproved, vet_approvedunknowninducerDetails
DB01201Rifapentineapproved, investigationalunknowninducerDetails
DB00418Secobarbitalapproved, vet_approvedunknowninducerDetails
DB00625Efavirenzapproved, investigationalunknowninhibitorDetails
DB01097Leflunomideapproved, investigationalunknownsubstrateinhibitorDetails
DB04868Nilotinibapproved, investigationalunknowninhibitorinducerDetails
DB00205Pyrimethamineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00398Sorafenibapproved, investigationalunknowninhibitorDetails
DB01101Capecitabineapproved, investigationalunknowninhibitorDetails
DB00544FluorouracilapprovedunknowninhibitorDetails
DB06268Sitaxentanapproved, investigational, withdrawnunknownsubstrateinhibitorDetails
DB00752Tranylcypromineapproved, investigationalunknowninhibitorDetails
DB01424Aminophenazoneapproved, withdrawnunknownsubstrateinhibitorDetails
DB00216Eletriptanapproved, investigationalunknownsubstrateDetails
DB00758ClopidogrelapprovedunknownsubstrateinhibitorDetails
DB00843DonepezilapprovedunknownsubstrateDetails
DB00661VerapamilapprovedunknownsubstrateinhibitorDetails
DB00425ZolpidemapprovedunknownsubstrateDetails
DB01036Tolterodineapproved, investigationalunknownsubstrateDetails
DB00328Indomethacinapproved, investigationalunknownsubstrateDetails
DB00936Salicylic acidapproved, investigational, vet_approvedunknownsubstrateDetails
DB01628Etoricoxibapproved, investigationalunknownsubstrateinhibitorDetails
DB00921Buprenorphineapproved, illicit, investigational, vet_approvedunknownsubstrateDetails
DB00818Propofolapproved, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB00672Chlorpropamideapproved, investigationalunknownsubstrateDetails
DB01120GliclazideapprovedunknownsubstrateDetails
DB00201CaffeineapprovedunknownsubstrateDetails
DB00514DextromethorphanapprovedunknownsubstrateDetails
DB01009Ketoprofenapproved, vet_approvedunknownsubstrateinhibitorDetails
DB04725LicofeloneinvestigationalunknownsubstrateDetails
DB06737Zaltoprofenapproved, investigationalunknownsubstrateDetails
DB06739SeratrodastapprovedunknownsubstrateinhibitorinducerDetails
DB06741GavestinelinvestigationalunknownsubstrateDetails
DB06738Ketobemidoneapproved, investigationalunknownsubstrateDetails
DB06736Aceclofenacapproved, investigationalunknownsubstrateDetails
DB00402Eszopicloneapproved, investigationalunknownsubstrateDetails
DB08798SulfamoxoleapprovedunknownsubstrateinhibitorDetails
DB06697ArtemetherapprovedunknownsubstrateDetails
DB00945Acetylsalicylic acidapproved, vet_approvedunknownsubstrateDetails
DB00381AmlodipineapprovedunknowninhibitorDetails
DB00613Amodiaquineapproved, investigationalunknowninhibitorDetails
DB00701Amprenavirapproved, investigationalunknownsubstrateDetails
DB01217Anastrozoleapproved, investigationalunknowninhibitorDetails
DB01117AtovaquoneapprovedunknowninhibitorDetails
DB00307Bexaroteneapproved, investigationalunknownsubstrateDetails
DB00835BrompheniramineapprovedunknownsubstrateDetails
DB01156BupropionapprovedunknownsubstrateDetails
DB00748CarbinoxamineapprovedunknownsubstrateDetails
DB00446Chloramphenicolapproved, vet_approvedunknowninhibitorDetails
DB00091Cyclosporineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00501Cimetidineapproved, investigationalunknowninhibitorDetails
DB00604Cisaprideapproved, investigational, withdrawnunknownsubstrateDetails
DB00257Clotrimazoleapproved, vet_approvedunknowninhibitorDetails
DB00907Cocaineapproved, illicitunknowninhibitorDetails
DB01394ColchicineapprovedunknowninhibitorinducerDetails
DB00169Cholecalciferolapproved, nutraceuticalunknowninhibitorDetails
DB01176CyclizineapprovedunknowninhibitorDetails
DB01191Dexfenfluramineapproved, illicit, investigational, withdrawnunknowninhibitorDetails
DB00647Dextropropoxypheneapproved, illicit, investigational, withdrawnunknowninhibitorDetails
DB01144Diclofenamideapproved, investigationalunknowninducerDetails
DB00266DicoumarolapprovedunknownsubstrateinhibitorDetails
DB00343Diltiazemapproved, investigationalunknownsubstrateinhibitorDetails
DB00822DisulfiramapprovedunknowninhibitorDetails
DB00757Dolasetronapproved, investigationalunknownsubstrateDetails
DB00988DopamineapprovedunknownsubstrateDetails
DB00869DorzolamideapprovedunknownsubstrateDetails
DB00668Epinephrineapproved, vet_approvedunknowninhibitorDetails
DB01240EpoprostenolapprovedunknownsubstrateDetails
DB00876EprosartanapprovedunknowninhibitorDetails
DB00783Estradiolapproved, investigational, vet_approvedunknownsubstrateDetails
DB00655EstroneapprovedunknownsubstrateDetails
DB00898EthanolapprovedunknowninhibitorDetails
DB01023Felodipineapproved, investigationalunknowninhibitorDetails
DB01195Flecainideapproved, withdrawnunknowninhibitorDetails
DB01544Flunitrazepamapproved, illicitunknownsubstrateDetails
DB00502HaloperidolapprovedunknownsubstrateDetails
DB01159Halothaneapproved, vet_approvedunknownsubstrateDetails
DB05381Histamineapproved, investigationalunknownsubstrateinhibitorDetails
DB01177IdarubicinapprovedunknownsubstrateDetails
DB00224IndinavirapprovedunknowninhibitorDetails
DB00281Lidocaineapproved, vet_approvedunknownsubstrateDetails
DB01601LopinavirapprovedunknowninhibitorDetails
DB00455Loratadineapproved, investigationalunknownsubstrateinhibitorDetails
DB00603Medroxyprogesterone acetateapproved, investigationalunknowninhibitorDetails
DB00333MethadoneapprovedunknownsubstrateDetails
DB00703MethazolamideapprovedunknowninhibitorDetails
DB01028Methoxyfluraneapproved, investigational, vet_approvedunknownsubstrateDetails
DB00370MirtazapineapprovedunknownsubstrateDetails
DB01171Moclobemideapproved, investigationalunknownsubstrateinhibitorDetails
DB00745Modafinilapproved, investigationalunknowninhibitorinducerDetails
DB00220NelfinavirapprovedunknowninhibitorDetails
DB00184NicotineapprovedunknownsubstrateDetails
DB01115NifedipineapprovedunknowninhibitorinducerDetails
DB00665Nilutamideapproved, investigationalunknowninhibitorDetails
DB06712Nilvadipineapproved, investigationalunknowninhibitorDetails
DB00334Olanzapineapproved, investigationalunknowninhibitorDetails
DB00904OndansetronapprovedunknownsubstrateDetails
DB00991OxaprozinapprovedunknownsubstrateDetails
DB00316AcetaminophenapprovedunknownsubstrateDetails
DB00850PerphenazineapprovedunknownsubstrateDetails
DB03783PhenacetinwithdrawnunknownsubstrateDetails
DB00191Phentermineapproved, illicitunknowninhibitorinducerDetails
DB01132Pioglitazoneapproved, investigationalunknownsubstrateinhibitorDetails
DB01411Pranlukastapproved, investigationalunknowninhibitorDetails
DB00175PravastatinapprovedunknownsubstrateinhibitorDetails
DB01131ProguanilapprovedunknownsubstrateDetails
DB01069Promethazineapproved, investigationalunknowninhibitorDetails
DB01182PropafenoneapprovedunknowninhibitorDetails
DB01589Quazepamapproved, illicitunknownsubstrateDetails
DB00908Quinidineapproved, investigationalunknownsubstrateinhibitorDetails
DB00533Rofecoxibapproved, investigational, withdrawnunknownsubstrateDetails
DB01698Rutinexperimental, investigationalunknowninhibitorDetails
DB01232Saquinavirapproved, investigationalunknowninhibitorDetails
DB01037Selegilineapproved, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB06150Sulfadimethoxineapproved, vet_approvedunknowninhibitorDetails
DB00576Sulfamethizoleapproved, investigational, vet_approvedunknowninhibitorDetails
DB00259SulfanilamideapprovedunknowninhibitorDetails
DB00891SulfapyridineapprovedunknowninhibitorDetails
DB01079Tegaserodapproved, investigational, withdrawnunknowninhibitorDetails
DB00231Temazepamapproved, investigationalunknownsubstrateDetails
DB00624Testosteroneapproved, investigationalunknownsubstrateDetails
DB00277TheophyllineapprovedunknownsubstrateDetails
DB00763MethimazoleapprovedunknowninhibitorDetails
DB00679Thioridazineapproved, withdrawnunknowninhibitorDetails
DB01007TioconazoleapprovedunknowninhibitorDetails
DB00323Tolcaponeapproved, withdrawnunknowninhibitorDetails
DB00897Triazolamapproved, investigationalunknowninhibitorDetails
DB00347TrimethadioneapprovedunknownsubstrateDetails
DB00726TrimipramineapprovedunknownsubstrateDetails
DB00197Troglitazoneinvestigational, withdrawnunknownsubstrateinhibitorDetails
DB04898Ximelagatranapproved, investigational, withdrawnunknownsubstrateDetails
DB00943Zalcitabineapproved, investigationalunknownsubstrateDetails
DB00495ZidovudineapprovedunknownsubstrateDetails
DB00755Tretinoinapproved, investigational, nutraceuticalunknownsubstrateDetails
DB01128BicalutamideapprovedunknowninhibitorDetails
DB01129Rabeprazoleapproved, investigationalunknowninhibitorDetails
DB01274Arformoterolapproved, investigationalunknownsubstrateDetails
DB04574Estrone sulfateapprovedunknowninducerDetails
DB06413Armodafinilapproved, investigationalunknowninhibitorDetails
DB00255Diethylstilbestrolapproved, investigationalunknowninhibitorDetails
DB00420Promazineapproved, vet_approvedunknownsubstrateDetails
DB06594Agomelatineapproved, investigationalunknowninhibitorDetails
DB04831TicrynafenwithdrawnunknownDetails
DB06174NoscapineinvestigationalunknowninhibitorDetails
DB04920Clevidipineapproved, investigationalunknowninhibitorDetails
DB06370IndisulaminvestigationalunknownsubstrateDetails
DB06803Niclosamideapproved, investigational, vet_approvedunknownsubstrateDetails
DB00515CisplatinapprovedunknowninhibitorDetails
DB00062Human Serum AlbuminapprovedunknowninhibitorDetails
DB06820SulconazoleapprovedunknowninhibitorDetails
DB01154Thiamylalapproved, vet_approvedunknownsubstrateDetails
DB08828Vismodegibapproved, investigationalnosubstrateinhibitorDetails
DB00374Treprostinilapproved, investigationalunknownsubstrateDetails
DB06204TapentadolapprovedunknownsubstrateDetails
DB06209PrasugrelapprovedyessubstrateDetails
DB08860PitavastatinapprovedunknownsubstrateDetails
DB08875Cabozantinibapproved, investigationalnosubstrateDetails
DB06605ApixabanapprovedunknownsubstrateDetails
DB08896RegorafenibapprovedunknowninhibitorDetails
DB08899EnzalutamideapprovedunknowninducerDetails
DB04938Ospemifeneapproved, investigationalunknownsubstrateDetails
DB00317Gefitinibapproved, investigationalunknowninhibitorDetails
DB06292DapagliflozinapprovednosubstrateDetails
DB09048Netupitantapproved, investigationalyessubstrateDetails
DB09080OlodaterolapprovednosubstrateDetails
DB09068Vortioxetineapproved, investigationalnosubstrateDetails
DB08439ParecoxibapprovedunknownsubstrateinhibitorDetails
DB09280LumacaftorapprovednoinhibitorinducerDetails
DB09570Ixazomibapproved, investigationalunknownsubstrateDetails
DB11560Lesinuradapproved, investigationalnosubstrateDetails
DB05812AbirateroneapprovedunknowninhibitorDetails
DB08816TicagrelorapprovedunknowninhibitorDetails
DB09063CeritinibapprovedunknowninhibitorDetails
DB00322FloxuridineapprovedunknowninhibitorDetails
DB05219Crisaboroleapproved, investigationalnoinhibitorDetails
DB06595Midostaurinapproved, investigationalunknowninhibitorinducerDetails
DB05015Belinostatapproved, investigationalunknowninhibitorDetails
DB05541Brivaracetamapproved, investigationalnosubstrateDetails
DB11611LifitegrastapprovedunknowninhibitorDetails
DB13174RheinexperimentalunknowninhibitorDetails
DB11994Diacereinapproved, investigationalunknowninhibitorDetails
DB03756Doconexentapproved, investigationalunknownsubstrateinhibitorDetails
DB11943Delafloxacinapproved, investigationalunknowninducerDetails
DB01685Topiroxostatapproved, investigationalunknowninhibitorDetails
DB09120Zucapsaicinapproved, investigationalunknowninhibitorDetails
DB09118StiripentolapprovedunknowninhibitorDetails
DB09198Lobeglitazoneapproved, investigationalnoinhibitorDetails
DB09167DosulepinapprovedunknowninhibitorDetails
DB11614RupatadineapprovednosubstrateDetails
DB12319Benzbromaroneinvestigational, withdrawnunknowninhibitorDetails
DB09238Manidipineapproved, investigationalunknowninhibitorDetails
DB13874Enasidenibapproved, investigationalunknownsubstrateinhibitorDetails
DB13919CandesartanexperimentalunknownsubstrateinhibitorDetails
DB12070Letermovirapproved, investigationalnoinducerDetails
DB12332Rucaparibapproved, investigationalunknowninhibitorDetails
DB09061Cannabidiolapproved, investigationalnosubstrateDetails
DB13943Testosterone cypionateapprovedunknownsubstrateDetails
DB13944Testosterone enanthateapprovedunknownsubstrateDetails
DB13946Testosterone undecanoateapproved, investigationalunknownsubstrateDetails
DB13952Estradiol acetateapproved, investigational, vet_approvedunknownsubstrateDetails
DB13953Estradiol benzoateapproved, investigational, vet_approvedunknownsubstrateDetails
DB13954Estradiol cypionateapproved, investigational, vet_approvedunknownsubstrateDetails
DB13955Estradiol dienanthateapproved, investigational, vet_approvedunknownsubstrateDetails
DB13956Estradiol valerateapproved, investigational, vet_approvedunknownsubstrateDetails
DB13941Piperaquineapproved, investigationalunknownsubstrateDetails
DB11901Apalutamideapproved, investigationalunknowninducerDetails
DB11633Isavuconazoleapproved, investigationalunknowninhibitorinducerDetails
DB11586Asunaprevirapproved, investigational, withdrawnnosubstrateDetails
DB13975Cimicifuga racemosaapproved, experimentalnoinhibitorDetails
DB14011Nabiximolsapproved, investigationalnosubstrateDetails
DB14009Medical Cannabisexperimental, investigationalnosubstrateDetails
DB13746Bioallethrinapproved, experimentalnosubstrateDetails
DB00486Nabiloneapproved, investigationalnoinhibitorDetails
DB14033Acetyl sulfisoxazoleapproved, vet_approvedunknownsubstrateinhibitorDetails
DB11995Avatrombopagapproved, investigationalunknowninducerDetails
DB11672Curcuminapproved, investigationalnoinhibitorDetails
DB00949FelbamateapprovedunknowninhibitorDetails
DB12582PiperineinvestigationalunknowninhibitorDetails