High affinity immunoglobulin gamma Fc receptor I

Details

Name
High affinity immunoglobulin gamma Fc receptor I
Synonyms
  • Fc-gamma RI
  • Fc-gamma RIA
  • FCG1
  • FcgammaRIa
  • FCGR1
  • FcRI
  • IGFR1
  • IgG Fc receptor I
Gene Name
FCGR1A
Organism
Human
Amino acid sequence
>lcl|BSEQ0001416|High affinity immunoglobulin gamma Fc receptor I
MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNG
TATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFTEGEPL
ALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAG
ISVTVKELFPAPVLNASVTSPLLEGNLVTLSCETKLLLQRPGLQLYFSFYMGSKTLRGRN
TSSEYQILTARREDSGLYWCEAATEDGNVLKRSPELELQVLGLQLPTPVWFHVLFYLAVG
IMFLVNTVLWVTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQ
LQEGVHRKEPQGAT
Number of residues
374
Molecular Weight
42631.525
Theoretical pI
8.08
GO Classification
Functions
receptor signaling protein activity
Processes
signal transduction / cytokine-mediated signaling pathway / immune response / antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent / antigen processing and presentation of peptide antigen via MHC class I / interferon-gamma-mediated signaling pathway / Fc-gamma receptor signaling pathway involved in phagocytosis / innate immune response / regulation of immune response / antigen processing and presentation of exogenous peptide antigen via MHC class I / phagocytosis, engulfment / intracellular signal transduction
Components
early endosome membrane / plasma membrane / integral component of membrane / clathrin-coated endocytic vesicle membrane
General Function
Receptor signaling protein activity
Specific Function
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Pfam Domain Function
Transmembrane Regions
293-313
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0016183|High affinity immunoglobulin gamma Fc receptor I (FCGR1A)
ATGTGGTTCTTGACAACTCTGCTCCTTTGGGTTCCAGTTGATGGGCAAGTGGACACCACA
AAGGCAGTGATCACTTTGCAGCCTCCATGGGTCAGCGTGTTCCAAGAGGAAACCGTAACC
TTGCACTGTGAGGTGCTCCATCTGCCTGGGAGCAGCTCTACACAGTGGTTTCTCAATGGC
ACAGCCACTCAGACCTCGACCCCCAGCTACAGAATCACCTCTGCCAGTGTCAATGACAGT
GGTGAATACAGGTGCCAGAGAGGTCTCTCAGGGCGAAGTGACCCCATACAGCTGGAAATC
CACAGAGGCTGGCTACTACTGCAGGTCTCCAGCAGAGTCTTCACGGAAGGAGAACCTCTG
GCCTTGAGGTGTCATGCGTGGAAGGATAAGCTGGTGTACAATGTGCTTTACTATCGAAAT
GGCAAAGCCTTTAAGTTTTTCCACTGGAATTCTAACCTCACCATTCTGAAAACCAACATA
AGTCACAATGGCACCTACCATTGCTCAGGCATGGGAAAGCATCGCTACACATCAGCAGGA
ATATCTGTCACTGTGAAAGAGCTATTTCCAGCTCCAGTGCTGAATGCATCTGTGACATCC
CCACTCCTGGAGGGGAATCTGGTCACCCTGAGCTGTGAAACAAAGTTGCTCTTGCAGAGG
CCTGGTTTGCAGCTTTACTTCTCCTTCTACATGGGCAGCAAGACCCTGCGAGGCAGGAAC
ACATCCTCTGAATACCAAATACTAACTGCTAGAAGAGAAGACTCTGGGTTATACTGGTGC
GAGGCTGCCACAGAGGATGGAAATGTCCTTAAGCGCAGCCCTGAGTTGGAGCTTCAAGTG
CTTGGCCTCCAGTTACCAACTCCTGTCTGGTTTCATGTCCTTTTCTATCTGGCAGTGGGA
ATAATGTTTTTAGTGAACACTGTTCTCTGGGTGACAATACGTAAAGAACTGAAAAGAAAG
AAAAAGTGGGATTTAGAAATCTCTTTGGATTCTGGTCATGAGAAGAAGGTAATTTCCAGC
CTTCAAGAAGACAGACATTTAGAAGAAGAGCTGAAATGTCAGGAACAAAAAGAAGAACAG
CTGCAGGAAGGGGTGCACCGGAAGGAGCCCCAGGGGGCCACGTAG
Chromosome Location
1
Locus
1q21.2-q21.3
External Identifiers
ResourceLink
UniProtKB IDP12314
UniProtKB Entry NameFCGR1_HUMAN
GenBank Protein ID31332
GenBank Gene IDX14356
GenAtlas IDFCGR1A
HGNC IDHGNC:3613
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00707Porfimer sodiumapproved, investigationalunknownantagonistDetails
DB00992Methyl aminolevulinateapproved, investigationalunknownantibodyDetails
DB00002CetuximabapprovedunknownDetails
DB00005Etanerceptapproved, investigationalunknownDetails
DB00028Immune Globulin Humanapproved, investigationalyesantagonistDetails
DB00054AbciximabapprovedunknownDetails
DB00056Gemtuzumab ozogamicinapproved, investigationalunknownDetails
DB00072Trastuzumabapproved, investigationalunknownDetails
DB00074Basiliximabapproved, investigationalunknownDetails
DB00075Muromonabapproved, investigationalunknownDetails
DB00078Ibritumomab tiuxetanapproved, investigationalunknownDetails
DB00081Tositumomabapproved, investigationalunknownDetails
DB00087Alemtuzumabapproved, investigationalunknownDetails
DB00092Alefaceptapproved, investigational, withdrawnunknownDetails
DB00095Efalizumabapproved, investigationalunknownDetails
DB00108Natalizumabapproved, investigationalunknownDetails
DB00110Palivizumabapproved, investigationalunknownDetails
DB00111Daclizumabinvestigational, withdrawnunknownDetails
DB00112Bevacizumabapproved, investigationalunknownDetails
DB11767Sarilumabapproved, investigationalunknownunknownDetails
DB06607Catumaxomabapproved, investigational, withdrawnyesagonistDetails