Photoactive yellow protein
Details
- Name
- Photoactive yellow protein
- Synonyms
- PYP
- Gene Name
- pyp
- Organism
- Halorhodospira halophila
- Amino acid sequence
>lcl|BSEQ0020525|Photoactive yellow protein MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGK NFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWV FVKRV
- Number of residues
- 125
- Molecular Weight
- 13873.54
- Theoretical pI
- 4.56
- GO Classification
- Functionsphotoreceptor activityProcessesphototransduction / protein-chromophore linkage / regulation of transcription, DNA-templated
- General Function
- Photoreceptor activity
- Specific Function
- Photoactive blue light protein. Probably functions as a photoreceptor for a negative phototaxis response.
- Pfam Domain Function
- PAS (PF00989)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0002570|378 bp ATGGAACACGTAGCCTTCGGTAGCGAGGACATCGAGAACACCCTCGCCAAGATGGACGAC GGCCAGCTCGACGGCCTGGCCTTCGGCGCCATCCAGCTCGACGGCGACGGCAACATCCTT CAGTACAACGCCGCGGAGGGCGACATCACCGGCCGCGACCCGAAGCAGGTCATCGGCAAG AACTTCTTCAAGGACGTGGCCCCGTGCACTGACAGCCCGGAGTTCTACGGCAAGTTCAAG GAAGGGGTGGCCTCGGGCAACCTGAACACGATGTTCGAGTACACCTTCGATTACCAAATG ACGCCCACGAAGGTGAAGGTGCACATGAAGAAGGCCCTCTCCGGCGACAGCTACTGGGTC TTCGTCAAGCGCGTCTAG
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P16113 UniProtKB Entry Name PYP_HALHA GenBank Protein ID 602429 GenBank Gene ID U17017 - General References
- Baca M, Borgstahl GE, Boissinot M, Burke PM, Williams DR, Slater KA, Getzoff ED: Complete chemical structure of photoactive yellow protein: novel thioester-linked 4-hydroxycinnamyl chromophore and photocycle chemistry. Biochemistry. 1994 Dec 6;33(48):14369-77. [Article]
- Kort R, Hoff WD, Van West M, Kroon AR, Hoffer SM, Vlieg KH, Crielaand W, Van Beeumen JJ, Hellingwerf KJ: The xanthopsins: a new family of eubacterial blue-light photoreceptors. EMBO J. 1996 Jul 1;15(13):3209-18. [Article]
- Van Beeumen JJ, Devreese BV, Van Bun SM, Hoff WD, Hellingwerf KJ, Meyer TE, McRee DE, Cusanovich MA: Primary structure of a photoactive yellow protein from the phototrophic bacterium Ectothiorhodospira halophila, with evidence for the mass and the binding site of the chromophore. Protein Sci. 1993 Jul;2(7):1114-25. [Article]
- Hoff WD, Devreese B, Fokkens R, Nugteren-Roodzant IM, Van Beeumen J, Nibbering N, Hellingwerf KJ: Chemical reactivity and spectroscopy of the thiol ester-linked p-coumaric acid chromophore in the photoactive yellow protein from Ectothiorhodospira halophila. Biochemistry. 1996 Jan 30;35(4):1274-81. [Article]
- McRee DE, Tainer JA, Meyer TE, Van Beeumen J, Cusanovich MA, Getzoff ED: Crystallographic structure of a photoreceptor protein at 2.4 A resolution. Proc Natl Acad Sci U S A. 1989 Sep;86(17):6533-7. [Article]
- Genick UK, Borgstahl GE, Ng K, Ren Z, Pradervand C, Burke PM, Srajer V, Teng TY, Schildkamp W, McRee DE, Moffat K, Getzoff ED: Structure of a protein photocycle intermediate by millisecond time-resolved crystallography. Science. 1997 Mar 7;275(5305):1471-5. [Article]
- Genick UK, Soltis SM, Kuhn P, Canestrelli IL, Getzoff ED: Structure at 0.85 A resolution of an early protein photocycle intermediate. Nature. 1998 Mar 12;392(6672):206-9. [Article]
- van Aalten DM, Crielaard W, Hellingwerf KJ, Joshua-Tor L: Conformational substates in different crystal forms of the photoactive yellow protein--correlation with theoretical and experimental flexibility. Protein Sci. 2000 Jan;9(1):64-72. [Article]
- Rubinstenn G, Vuister GW, Mulder FA, Dux PE, Boelens R, Hellingwerf KJ, Kaptein R: Structural and dynamic changes of photoactive yellow protein during its photocycle in solution. Nat Struct Biol. 1998 Jul;5(7):568-70. [Article]