UDP-glucuronosyltransferase 2B7

Details

Name
UDP-glucuronosyltransferase 2B7
Synonyms
  • 2.4.1.17
  • 3,4-catechol estrogen-specific UDPGT
  • UDP-glucuronosyltransferase 2B9
  • UDPGT 2B7
  • UDPGT 2B9
  • UDPGTh-2
  • UGTB2B9
Gene Name
UGT2B7
Organism
Human
Amino acid sequence
>lcl|BSEQ0012557|UDP-glucuronosyltransferase 2B7
MSVKWTSVILLIQLSFCFSSGNCGKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSA
SILFDPNNSSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFG
DITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTF
EKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFEIFDMKKWDQFYSEVL
GRPTTLSETMGKADVWLIRNSWNFQFPHPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSG
ENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTM
SSTDLLNALKRVINDPSYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLTWFQYHSLDVIGFLLVCVATVIFIVTKCCLFCFWKFARKAKKGKND
Number of residues
529
Molecular Weight
60694.12
Theoretical pI
8.45
GO Classification
Functions
glucuronosyltransferase activity
Processes
flavonoid glucuronidation / lipid metabolic process / cellular response to hormone stimulus / androgen metabolic process / cellular glucuronidation / flavonoid biosynthetic process
Components
membrane / endoplasmic reticulum membrane / integral component of membrane / extracellular exosome / intracellular membrane-bounded organelle
General Function
Glucuronosyltransferase activity
Specific Function
UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.Its unique specificity for 3,4-catechol estrogens and estriol suggests it may play an important role in regulating the level and activity of these potent and active estrogen metabolites. Is also active with androsterone, hyodeoxycholic acid and tetrachlorocatechol (in vitro).
Pfam Domain Function
Transmembrane Regions
493-509
Cellular Location
Microsome membrane
Gene sequence
>lcl|BSEQ0012558|UDP-glucuronosyltransferase 2B7 (UGT2B7)
ATGTCTGTGAAATGGACTTCAGTAATTTTGCTAATACAACTGAGCTTTTGCTTTAGCTCT
GGGAATTGTGGAAAGGTGCTGGTGTGGGCAGCAGAATACAGCCATTGGATGAATATAAAG
ACAATCCTGGATGAGCTTATTCAGAGAGGTCATGAGGTGACTGTACTGGCATCTTCAGCT
TCCATTCTTTTTGATCCCAACAACTCATCCGCTCTTAAAATTGAAATTTATCCCACATCT
TTAACTAAAACTGAGTTGGAGAATTTCATCATGCAACAGATTAAGAGATGGTCAGACCTT
CCAAAAGATACATTTTGGTTATATTTTTCACAAGTACAGGAAATCATGTCAATATTTGGT
GACATAACTAGAAAGTTCTGTAAAGATGTAGTTTCAAATAAGAAATTTATGAAAAAAGTA
CAAGAGTCAAGATTTGACGTCATTTTTGCAGATGCTATTTTTCCCTGTAGTGAGCTGCTG
GCTGAGCTATTTAACATACCCTTTGTGTACAGTCTCAGCTTCTCTCCTGGCTACACTTTT
GAAAAGCATAGTGGAGGATTTATTTTCCCTCCTTCCTACGTACCTGTTGTTATGTCAGAA
TTAACTGATCAAATGACTTTCATGGAGAGGGTAAAAAATATGATCTATGTGCTTTACTTT
GACTTTTGGTTCGAAATATTTGACATGAAGAAGTGGGATCAGTTTTATAGTGAAGTTCTA
GGAAGACCCACTACATTATCTGAGACAATGGGGAAAGCTGACGTATGGCTTATTCGAAAC
TCCTGGAATTTTCAGTTTCCATATCCACTCTTACCAAATGTTGATTTTGTTGGAGGACTC
CACTGCAAACCTGCCAAACCCCTGCCTAAGGAAATGGAAGACTTTGTACAGAGCTCTGGA
GAAAATGGTGTTGTGGTGTTTTCTCTGGGGTCAATGGTCAGTAACATGACAGAAGAAAGG
GCCAACGTAATTGCATCAGCCCTGGCCCAGATCCCACAAAAGGTTCTGTGGAGATTTGAT
GGGAATAAACCAGATACCTTAGGTCTCAATACTCGGCTCTACAAGTGGATACCCCAGAAT
GACCTTCTAGGTCATCCAAAGACCAGAGCTTTTATAACTCATGGTGGAGCCAATGGCATC
TACGAGGCAATCTACCATGGGATCCCTATGGTGGGGATTCCATTGTTTGCCGATCAACCT
GATAACATTGCTCACATGAAGGCCAGGGGAGCAGCTGTTAGAGTGGACTTCAACACAATG
TCGAGTACAGACTTGCTGAATGCATTGAAGAGAGTAATTAATGATCCTTCATATAAAGAG
AATGTTATGAAATTATCAAGAATTCAACATGATCAACCAGTGAAGCCCCTGGATCGAGCA
GTCTTCTGGATTGAATTTGTCATGCGCCACAAAGGAGCTAAACACCTTCGGGTTGCAGCC
CACGACCTCACCTGGTTCCAGTACCACTCTTTGGATGTGATTGGGTTCCTGCTGGTCTGT
GTGGCAACTGTGATATTTATCGTCACAAAATGTTGTCTGTTTTGTTTCTGGAAGTTTGCT
AGAAAAGCAAAGAAGGGAAAAAATGATTAG
Chromosome Location
4
Locus
4q13
External Identifiers
ResourceLink
UniProtKB IDP16662
UniProtKB Entry NameUD2B7_HUMAN
GenBank Protein ID340080
GenBank Gene IDJ05428
HGNC IDHGNC:12554
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00678LosartanapprovedunknownsubstrateDetails
DB00586Diclofenacapproved, vet_approvedunknownsubstrateDetails
DB00749Etodolacapproved, investigational, vet_approvedunknownsubstrateDetails
DB00712Flurbiprofenapproved, investigationalunknownsubstrateDetails
DB01050IbuprofenapprovedunknownsubstrateDetails
DB00788Naproxenapproved, vet_approvedunknownsubstrateDetails
DB00870Suprofenapproved, withdrawnunknownsubstrateDetails
DB01252MitiglinideinvestigationalunknownsubstrateDetails
DB06737ZaltoprofenexperimentalunknownsubstrateDetails
DB01544Flunitrazepamapproved, illicitunknowninhibitorDetails
DB06403Ambrisentanapproved, investigationalunknownsubstrateDetails
DB00197Troglitazoneinvestigational, withdrawnunknownsubstrateDetails
DB00295Morphineapproved, investigationalunknownsubstrateDetails
DB00328Indometacinapproved, investigationalunknownsubstrateinhibitorDetails
DB00688Mycophenolate mofetilapproved, investigationalunknownsubstrateDetails
DB00973EzetimibeapprovedunknownsubstrateDetails
DB01024Mycophenolic acidapprovedunknownsubstrateDetails
DB06777Chenodeoxycholic acidapprovedunknowninhibitorDetails
DB06235VadimezaninvestigationalunknownsubstrateDetails
DB00445EpirubicinapprovedunknownsubstrateDetails
DB06204TapentadolapprovedunknownsubstrateDetails
DB08860PitavastatinapprovedunknownsubstrateDetails
DB06695Dabigatran etexilateapprovedunknownDetails
DB06207SilodosinapprovedunknownsubstrateDetails
DB00495ZidovudineapprovedunknownsubstrateDetails
DB01076AtorvastatinapprovedunknownsubstrateDetails
DB00227Lovastatinapproved, investigationalunknownsubstrateDetails
DB00641SimvastatinapprovedunknownsubstrateDetails
DB00842OxazepamapprovedunknownsubstrateDetails
DB00564Carbamazepineapproved, investigationalunknownsubstrateDetails
DB00318Codeineapproved, illicitunknownsubstrateDetails
DB01095FluvastatinapprovedunknownsubstrateDetails
DB00313Valproic Acidapproved, investigationalunknownsubstrateDetails
DB06292DapagliflozinapprovednosubstrateDetails
DB13874Enasidenibapproved, investigationalunknownsubstrateDetails
DB06230Nalmefeneapproved, investigational, withdrawnnosubstrateDetails
DB13783Acemetacinapproved, experimental, investigationalnosubstrateDetails
DB11827Ertugliflozinapproved, investigationalnosubstrateDetails
DB11638Artenimolexperimental, investigationalnosubstrateDetails
DB01026Ketoconazoleapproved, investigationalunknowninhibitorDetails
DB05928DovitinibinvestigationalunknowninhibitorDetails
DB09213Dexibuprofenapproved, investigationalunknownDetails
DB01174Phenobarbitalapproved, investigationalunknowninducerDetails