NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7

Details

Name
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
Synonyms
  • Cell adhesion protein SQM1
  • CI-B18
  • Complex I-B18
  • NADH-ubiquinone oxidoreductase B18 subunit
Gene Name
NDUFB7
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037032|NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCA
HHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAA
ELAKGQGPGEVDPKVAL
Number of residues
137
Molecular Weight
16401.82
Theoretical pI
9.21
GO Classification
Functions
NADH dehydrogenase (ubiquinone) activity
Processes
cellular metabolic process / mitochondrial electron transport, NADH to ubiquinone / respiratory electron transport chain / small molecule metabolic process
Components
mitochondrial inner membrane / mitochondrial intermembrane space / mitochondrial respiratory chain complex I / mitochondrion
General Function
Nadh dehydrogenase (ubiquinone) activity
Specific Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Mitochondrion inner membrane
Gene sequence
>lcl|BSEQ0010361|NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 (NDUFB7)
ATGGGGGCCCACCTGGTCCGGCGCTACCTGGGCGATGCCTCGGTGGAGCCCGACCCCCTG
CAGATGCCAACCTTCCCGCCAGACTACGGCTTCCCCGAACGCAAGGAGCGCGAGATGGTG
GCCACACAGCAGGAGATGATGGACGCGCAGCTGAGGCTCCAGCTGCGGGACTACTGCGCC
CACCACCTCATCCGGCTGCTCAAGTGCAAGCGTGACAGCTTCCCCAACTTCCTGGCCTGC
AAGCAGGAGCGGCACGACTGGGACTACTGCGAGCACCGCGACTATGTGATGCGCATGAAG
GAGTTTGAGCGGGAGCGGAGGCTGCTCCAGCGGAAGAAGCGGCGGGAGAAGAAGGCGGCA
GAGTTGGCCAAAGGCCAGGGACCCGGGGAAGTGGACCCCAAGGTGGCCCTGTAG
Chromosome Location
19
Locus
19p13.12-p13.11
External Identifiers
ResourceLink
UniProtKB IDP17568
UniProtKB Entry NameNDUB7_HUMAN
GenBank Protein ID180233
GenBank Gene IDM33374
GenAtlas IDNDUFB7
HGNC IDHGNC:7702
General References
  1. Wong YC, Tsao SW, Kakefuda M, Bernal SD: cDNA cloning of a novel cell adhesion protein expressed in human squamous carcinoma cells. Biochem Biophys Res Commun. 1990 Jan 30;166(2):984-92. [Article]
  2. Triepels R, Smeitink J, Loeffen J, Smeets R, Trijbels F, van den Heuvel L: Characterization of the human complex I NDUFB7 and 17.2-kDa cDNAs and mutational analysis of 19 genes of the HP fraction in complex I-deficient-patients. Hum Genet. 2000 Apr;106(4):385-91. [Article]
  3. Hu RM, Han ZG, Song HD, Peng YD, Huang QH, Ren SX, Gu YJ, Huang CH, Li YB, Jiang CL, Fu G, Zhang QH, Gu BW, Dai M, Mao YF, Gao GF, Rong R, Ye M, Zhou J, Xu SH, Gu J, Shi JX, Jin WR, Zhang CK, Wu TM, Huang GY, Chen Z, Chen MD, Chen JL: Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning. Proc Natl Acad Sci U S A. 2000 Aug 15;97(17):9543-8. [Article]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  5. Murray J, Zhang B, Taylor SW, Oglesbee D, Fahy E, Marusich MF, Ghosh SS, Capaldi RA: The subunit composition of the human NADH dehydrogenase obtained by rapid one-step immunopurification. J Biol Chem. 2003 Apr 18;278(16):13619-22. Epub 2003 Feb 28. [Article]
  6. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
  7. Szklarczyk R, Wanschers BF, Nabuurs SB, Nouws J, Nijtmans LG, Huynen MA: NDUFB7 and NDUFA8 are located at the intermembrane surface of complex I. FEBS Lett. 2011 Mar 9;585(5):737-43. doi: 10.1016/j.febslet.2011.01.046. Epub 2011 Feb 22. [Article]
  8. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00157NADHapproved, nutraceuticalunknownDetails