Alpha-2B adrenergic receptor

Details

Name
Alpha-2B adrenergic receptor
Synonyms
  • ADRA2L1
  • ADRA2RL1
  • Alpha-2 adrenergic receptor subtype C2
  • Alpha-2B adrenoceptor
  • Alpha-2B adrenoreceptor
  • Alpha-2BAR
Gene Name
ADRA2B
Organism
Human
Amino acid sequence
>lcl|BSEQ0010396|Alpha-2B adrenergic receptor
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV
ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE
EEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQL
TREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSSLNP
VIYTIFNQDFRRAFRRILCRPWTQTAW
Number of residues
447
Molecular Weight
49565.8
Theoretical pI
8.52
GO Classification
Functions
alpha2-adrenergic receptor activity / epinephrine binding
Processes
blood coagulation / activation of MAPK activity by adrenergic receptor signaling pathway / activation of protein kinase B activity / epidermal growth factor-activated receptor transactivation by G-protein coupled receptor signaling pathway / cell-cell signaling / negative regulation of epinephrine secretion / platelet activation / regulation of smooth muscle contraction / regulation of vasoconstriction / G-protein coupled receptor signaling pathway / negative regulation of norepinephrine secretion / positive regulation of neuron differentiation
Components
plasma membrane / integral component of plasma membrane
General Function
Epinephrine binding
Specific Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins. The rank order of potency for agonists of this receptor is clonidine > norepinephrine > epinephrine = oxymetazoline > dopamine > p-tyramine = phenylephrine > serotonin > p-synephrine / p-octopamine. For antagonists, the rank order is yohimbine > chlorpromazine > phentolamine > mianserine > spiperone > prazosin > alprenolol > propanolol > pindolol.
Pfam Domain Function
Transmembrane Regions
13-38 49-69 87-107 129-149 173-193 370-393 403-423
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010397|Alpha-2B adrenergic receptor (ADRA2B)
ATGGACCACCAGGACCCCTACTCCGTGCAGGCCACAGCGGCCATAGCGGCGGCCATCACC
TTCCTCATTCTCTTTACCATCTTCGGCAACGCTCTGGTCATCCTGGCTGTGTTGACCAGC
CGCTCGCTGCGCGCCCCTCAGAACCTGTTCCTGGTGTCGCTGGCCGCCGCCGACATCCTG
GTGGCCACGCTCATCATCCCTTTCTCGCTGGCCAACGAGCTGCTGGGCTACTGGTACTTC
CGGCGCACGTGGTGCGAGGTGTACCTGGCGCTCGACGTGCTCTTCTGCACCTCGTCCATC
GTGCACCTGTGCGCCATCAGCCTGGACCGCTACTGGGCCGTGAGCCGCGCGCTGGAGTAC
AACTCCAAGCGCACCCCGCGCCGCATCAAGTGCATCATCCTCACTGTGTGGCTCATCGCC
GCCGTCATCTCGCTGCCGCCCCTCATCTACAAGGGCGACCAGGGCCCCCAGCCGCGCGGG
CGCCCCCAGTGCAAGCTCAACCAGGAGGCCTGGTACATCCTGGCCTCCAGCATCGGATCT
TTCTTTGCTCCTTGCCTCATCATGATCCTTGTCTACCTGCGCATCTACCTGATCGCCAAA
CGCAGCAACCGCAGAGGTCCCAGGGCCAAGGGGGGGCCTGGGCAGGGTGAGTCCAAGCAG
CCCCGACCCGACCATGGTGGGGCTTTGGCCTCAGCCAAACTGCCAGCCCTGGCCTCTGTG
GCTTCTGCCAGAGAGGTCAACGGACACTCGAAGTCCACTGGGGAGAAGGAGGAGGGGGAG
ACCCCTGAAGATACTGGGACCCGGGCCTTGCCACCCAGTTGGGCTGCCCTTCCCAACTCA
GGCCAGGGCCAGAAGGAGGGTGTTTGTGGGGCATCTCCAGAGGATGAAGCTGAAGAGGAG
GAAGAGGAGGAGGAGGAGGAGGAAGAGTGTGAACCCCAGGCAGTGCCAGTGTCTCCGGCC
TCAGCTTGCAGCCCCCCGCTGCAGCAGCCACAGGGCTCCCGGGTGCTGGCCACCCTACGT
GGCCAGGTGCTCCTGGGCAGGGGCGTGGGTGCTATAGGTGGGCAGTGGTGGCGTCGACGG
GCGCAGCTGACCCGGGAGAAGCGCTTCACCTTCGTGCTGGCTGTGGTCATTGGCGTTTTT
GTGCTCTGCTGGTTCCCCTTCTTCTTCAGCTACAGCCTGGGAGCCATCTGCCCGAAGCAC
TGCAAGGTGCCCCATGGCCTCTTCCAGTTCTTCTTCTGGATCGGCTACTGCAACAGCTCA
CTGAACCCTGTTATCTACACCATCTTCAACCAGGACTTCCGCCGTGCCTTCCGGAGGATC
CTGTGCCGCCCGTGGACCCAGACGGCCTGGTGA
Chromosome Location
2
Locus
2p13-q13
External Identifiers
ResourceLink
UniProtKB IDP18089
UniProtKB Entry NameADA2B_HUMAN
GenBank Protein ID178198
GenBank Gene IDM34041
GenAtlas IDADRA2B
HGNC IDHGNC:282
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00800FenoldopamapprovedunknownantagonistDetails
DB01392Yohimbineapproved, investigational, vet_approvedyesantagonistDetails
DB00484BrimonidineapprovedyesagonistDetails
DB00368NorepinephrineapprovedyesagonistDetails
DB00696Ergotamineapprovedunknownagonistpartial agonistDetails
DB04855DronedaroneapprovedunknownDetails
DB05461OPC-28326investigationalunknownDetails
DB05492Epicept NP-1investigationalunknownDetails
DB06262Droxidopaapproved, investigationalyesagonistDetails
DB06216AsenapineapprovedunknownantagonistDetails
DB06229OcaperidoneinvestigationalunknownDetails
DB00575ClonidineapprovedyesagonistDetails
DB01186Pergolideapproved, investigational, vet_approved, withdrawnunknownagonistDetails
DB01200Bromocriptineapproved, investigationalunknownagonistDetails
DB00589Lisurideapproved, investigationalunknownother/unknownDetails
DB00248CabergolineapprovedunknownantagonistDetails
DB00413Pramipexoleapproved, investigationalunknownunknownDetails
DB00268Ropiniroleapproved, investigationalunknownagonistDetails
DB00714Apomorphineapproved, investigationalunknownagonistDetails
DB00734Risperidoneapproved, investigationalunknownantagonistagonistDetails
DB01267PaliperidoneapprovedunknownantagonistDetails
DB01224QuetiapineapprovedunknownantagonistDetails
DB00697Tizanidineapproved, investigationalyesagonistDetails
DB00246ZiprasidoneapprovednoantagonistDetails
DB00363ClozapineapprovednoantagonistDetails
DB01238Aripiprazoleapproved, investigationalnoantagonistDetails
DB00334Olanzapineapproved, investigationalunknownantagonistDetails
DB01403Methotrimeprazineapproved, investigationalunknownantagonistDetails
DB00292EtomidateapprovedyesagonistDetails
DB00726Trimipramineapprovedunknownother/unknownDetails
DB01142Doxepinapproved, investigationalunknownantagonistDetails
DB00925PhenoxybenzamineapprovedunknownantagonistDetails
DB01363Ephedraapproved, nutraceutical, withdrawnyesagonistDetails
DB01577Methamphetamineapproved, illicityesagonistDetails
DB06694Xylometazolineapproved, investigationalyesagonistDetails
DB00668Epinephrineapproved, vet_approvedyesagonistDetails
DB05271RotigotineapprovedunknownantagonistDetails
DB00408LoxapineapprovedunknownbinderDetails
DB01136Carvedilolapproved, investigationalunknownantagonistDetails
DB00457PrazosinapprovedunknownbinderDetails
DB00629Guanabenzapproved, investigationalunknownbinderDetails
DB00797Tolazolineapproved, vet_approvedunknownbinderDetails
DB00935Oxymetazolineapproved, investigationalunknownbinderDetails
DB00964ApraclonidineapprovedunknownagonistDetails
DB01018Guanfacineapproved, investigationalunknownbinderDetails
DB06148Mianserinapproved, investigationalunknownantagonistDetails
DB00217BethanidineapprovedyesagonistDetails
DB01049Ergoloid mesylateapprovedyesantagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknownDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB00540NortriptylineapprovedunknownantagonistDetails
DB00934Maprotilineapproved, investigationalunknownantagonistDetails
DB01151Desipramineapproved, investigationalunknownbinderDetails
DB09202CirazolineexperimentalyesantagonistDetails
DB06678EsmirtazapineinvestigationalunknownantagonistDetails
DB06707LevonordefrinapprovedyesagonistDetails
DB13025Tiaprideapproved, investigationalyesantagonistDetails
DB09167DosulepinapprovedyesantagonistDetails
DB09304SetiptilineapprovedunknownantagonistDetails
DB00841DobutamineapprovedunknownDetails
DB00397Phenylpropanolamineapproved, vet_approved, withdrawnunknownDetails
DB09194EtoperidonewithdrawnunknownantagonistDetails
DB09195LorpiprazoleapprovedyesantagonistDetails
DB01365MephentermineapprovedyesagonistDetails
DB00182Amphetamineapproved, illicit, investigationalunknownagonistDetails
DB09205Moxisylyteapproved, investigationalyesantagonistDetails
DB09229Aranidipineapproved, investigationalunknownagonistDetails