Alpha-2C adrenergic receptor

Details

Name
Alpha-2C adrenergic receptor
Synonyms
  • ADRA2L2
  • ADRA2RL2
  • Alpha-2 adrenergic receptor subtype C4
  • Alpha-2C adrenoceptor
  • Alpha-2C adrenoreceptor
  • Alpha-2CAR
Gene Name
ADRA2C
Organism
Human
Amino acid sequence
>lcl|BSEQ0000681|Alpha-2C adrenergic receptor
MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGF
LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG
QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA
VISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR
TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGA
LRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRR
RRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK
FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Number of residues
462
Molecular Weight
49521.585
Theoretical pI
10.69
GO Classification
Functions
epinephrine binding / alpha2-adrenergic receptor activity / protein heterodimerization activity / protein homodimerization activity / alpha-2A adrenergic receptor binding
Processes
regulation of sensory perception of pain / G-protein coupled receptor signaling pathway / blood coagulation / regulation of insulin secretion / activation of MAPK activity by adrenergic receptor signaling pathway / activation of protein kinase B activity / adenylate cyclase-inhibiting adrenergic receptor signaling pathway / cell-cell signaling / negative regulation of norepinephrine secretion / epidermal growth factor-activated receptor transactivation by G-protein coupled receptor signaling pathway / platelet activation / female pregnancy / negative regulation of epinephrine secretion / small molecule metabolic process / negative regulation of adenylate cyclase activity / negative regulation of insulin secretion involved in cellular response to glucose stimulus / positive regulation of vasoconstriction / negative regulation of uterine smooth muscle contraction / positive regulation of neuron differentiation / energy reserve metabolic process
Components
cytoplasm / plasma membrane / endosome / integral component of plasma membrane / axon terminus
General Function
Protein homodimerization activity
Specific Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
Pfam Domain Function
Transmembrane Regions
52-76 89-114 125-147 169-191 208-231 380-407 421-441
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010255|Alpha-2C adrenergic receptor (ADRA2C)
ATGGCGTCCCCGGCGCTGGCGGCGGCGCTGGCGGTGGCGGCAGCGGCGGGCCCCAATGCG
AGCGGCGCGGGCGAGAGGGGCAGCGGCGGGGTTGCCAATGCCTCGGGGGCTTCCTGGGGG
CCGCCGCGCGGCCAGTACTCGGCGGGCGCGGTGGCAGGGCTGGCTGCCGTGGTGGGCTTC
CTCATCGTCTTCACCGTGGTGGGCAACGTGCTGGTGGTGATCGCCGTGCTGACCAGCCGG
GCGCTGCGCGCGCCACAGAACCTCTTCCTGGTGTCGCTGGCCTCGGCCGACATCCTGGTG
GCCACGCTGGTCATGCCCTTCTCGTTGGCCAACGAGCTCATGGCCTACTGGTACTTCGGG
CAGGTGTGGTGCGGCGTGTACCTGGCGCTCGATGTGCTGTTTTGCACCTCGTCGATCGTG
CATCTGTGTGCCATCAGCCTGGACCGCTACTGGTCGGTGACGCAGGCCGTCGAGTACAAC
CTGAAGCGCACACCACGCCGCGTCAAGGCCACCATCGTGGCCGTGTGGCTCATCTCGGCC
GTCATCTCCTTCCCGCCGCTGGTCTCGCTCTACCGCCAGCCCGACGGCGCCGCCTACCCG
CAGTGCGGCCTCAACGACGAGACCTGGTACATCCTGTCCTCCTGCATCGGCTCCTTCTTC
GCGCCCTGCCTCATCATGGGCCTGGTCTACGCGCGCATCTACCGAGTGGCCAAGCTGCGC
ACGCGCACGCTCAGCGAGAAGCGCGCCCCCGTGGGCCCCGACGGTGCGTCCCCGACTACC
GAAAACGGGCTGGGCGCGGCGGCAGGCGCAGGCGAGAACGGGCACTGCGCGCCCCCGCCC
GCCGACGTGGAGCCGGACGAGAGCAGCGCAGCGGCCGAGAGGCGGCGGCGCCGGGGCGCG
TTGCGGCGGGGCGGGCGGCGGCGAGCGGGCGCGGAGGGGGGCGCGGGCGGTGCGGACGGG
CAGGGGGCGGGGCCGGGGGCGGCTGAGTCGGGGGCGCTGACCGCCTCCAGGTCCCCGGGG
CCCGGTGGCCGCCTGTCGCGCGCCAGCTCGCGCTCCGTCGAGTTCTTCCTGTCGCGCCGG
CGCCGGGCGCGCAGCAGCGTGTGCCGCCGCAAGGTGGCCCAGGCGCGCGAGAAGCGCTTC
ACCTTTGTGCTGGCTGTGGTCATGGGCGTGTTCGTGCTCTGCTGGTTCCCCTTCTTCTTC
AGCTACAGCCTGTACGGCATCTGCCGCGAGGCCTGCCAGGTGCCCGGCCCGCTCTTCAAG
TTCTTCTTCTGGATCGGCTACTGCAACAGCTCGCTCAACCCGGTCATCTACACGGTCTTC
AACCAGGATTTCCGGCGATCCTTTAAGCACATCCTCTTCCGACGGAGGAGAAGGGGCTTC
AGGCAGTGA
Chromosome Location
4
Locus
4p16
External Identifiers
ResourceLink
UniProtKB IDP18825
UniProtKB Entry NameADA2C_HUMAN
GenBank Protein ID178194
GenBank Gene IDJ03853
GenAtlas IDADRA2C
HGNC IDHGNC:283
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00800FenoldopamapprovedunknownantagonistDetails
DB01392Yohimbineapproved, investigational, vet_approvedyesantagonistDetails
DB00484BrimonidineapprovedyesagonistDetails
DB00368NorepinephrineapprovedyesagonistDetails
DB04855DronedaroneapprovedunknownDetails
DB05461OPC-28326investigationalunknownDetails
DB05492Epicept NP-1investigationalunknownDetails
DB06262Droxidopaapproved, investigationalyesagonistDetails
DB06216AsenapineapprovedunknownantagonistDetails
DB06229OcaperidoneinvestigationalunknownDetails
DB00575ClonidineapprovedyesagonistDetails
DB01186Pergolideapproved, investigational, vet_approved, withdrawnunknownagonistDetails
DB01200Bromocriptineapproved, investigationalunknownagonistDetails
DB00589Lisurideapproved, investigationalunknownother/unknownDetails
DB00248CabergolineapprovedunknownantagonistDetails
DB00413Pramipexoleapproved, investigationalunknownunknownDetails
DB00268Ropiniroleapproved, investigationalunknownagonistDetails
DB00714Apomorphineapproved, investigationalunknownagonistDetails
DB00734Risperidoneapproved, investigationalunknownagonistDetails
DB01267PaliperidoneapprovedunknownagonistDetails
DB01224QuetiapineapprovedunknownantagonistDetails
DB00697Tizanidineapproved, investigationalyesagonistDetails
DB00246ZiprasidoneapprovednoantagonistDetails
DB00363ClozapineapprovednoantagonistDetails
DB01238Aripiprazoleapproved, investigationalnoantagonistother/unknownDetails
DB00334Olanzapineapproved, investigationalunknownantagonistDetails
DB01403Methotrimeprazineapproved, investigationalunknownantagonistDetails
DB01142Doxepinapproved, investigationalunknownantagonistDetails
DB00925PhenoxybenzamineapprovedunknownantagonistDetails
DB01363Ephedraapproved, nutraceutical, withdrawnyesagonistDetails
DB01577Methamphetamineapproved, illicityesagonistDetails
DB06694Xylometazolineapproved, investigationalunknownagonistDetails
DB08815Lurasidoneapproved, investigationalunknownantagonistDetails
DB04946IloperidoneapprovedunknownantagonistDetails
DB08838Agmatineexperimental, investigationalyesagonistDetails
DB00408LoxapineapprovedunknownbinderDetails
DB00370MirtazapineapprovedunknownbinderDetails
DB01136Carvedilolapproved, investigationalunknownantagonistDetails
DB00668Epinephrineapproved, vet_approvedunknownagonistDetails
DB00797Tolazolineapproved, vet_approvedunknownbinderDetails
DB00935Oxymetazolineapproved, investigationalunknownagonistDetails
DB06148Mianserinapproved, investigationalunknownantagonistDetails
DB09128Brexpiprazoleapproved, investigationalyesantagonistDetails
DB00217BethanidineapprovedyesagonistDetails
DB01049Ergoloid mesylateapprovedyesantagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknownDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB00540NortriptylineapprovedunknownantagonistDetails
DB00934Maprotilineapproved, investigationalunknownantagonistDetails
DB01151Desipramineapproved, investigationalunknownbinderDetails
DB09202CirazolineexperimentalyesantagonistDetails
DB06678EsmirtazapineinvestigationalunknownantagonistDetails
DB06707LevonordefrinapprovedyesagonistDetails
DB13025Tiaprideapproved, investigationalyesantagonistDetails
DB09167DosulepinapprovedyesantagonistDetails
DB09304SetiptilineapprovedunknownantagonistDetails
DB00841DobutamineapprovedunknownDetails
DB00397Phenylpropanolamineapproved, vet_approved, withdrawnunknownDetails
DB09194EtoperidonewithdrawnunknownantagonistDetails
DB09195LorpiprazoleapprovedyesantagonistDetails
DB01365MephentermineapprovedyesagonistDetails
DB00182Amphetamineapproved, illicit, investigationalunknownagonistDetails
DB09205Moxisylyteapproved, investigationalyesantagonistDetails
DB09229Aranidipineapproved, investigationalunknownagonistDetails