Cytochrome P450 2B6

Details

Name
Cytochrome P450 2B6
Synonyms
  • 1,4-cineole 2-exo-monooxygenase
  • 1.14.13.-
  • CYPIIB6
  • Cytochrome P450 IIB1
Gene Name
CYP2B6
Organism
Human
Amino acid sequence
>lcl|BSEQ0006839|Cytochrome P450 2B6
MELSVLLFLALLTGLLLLLVQRHPNTHDRLPPGPRPLPLLGNLLQMDRRGLLKSFLRFRE
KYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNR
WKVLRRFSVTTMRDFGMGKRSVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIIC
SIVFGKRFHYQDQEFLKMLNLFYQTFSLISSVFGQLFELFSGFLKYFPGAHRQVYKNLQE
INAYIGHSVEKHRETLDPSAPKDLIDTYLLHMEKEKSNAHSEFSHQNLNLNTLSLFFAGT
ETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYEIQRFS
DLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFLDANGAL
KKTEAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGKI
PPTYQIRFLPR
Number of residues
491
Molecular Weight
56277.81
Theoretical pI
8.44
GO Classification
Functions
iron ion binding / heme binding / monooxygenase activity / oxygen binding / arachidonic acid epoxygenase activity / oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen / steroid hydroxylase activity
Processes
steroid metabolic process / xenobiotic metabolic process / drug metabolic process / epoxygenase P450 pathway / exogenous drug catabolic process / small molecule metabolic process / cellular ketone metabolic process / oxidation-reduction process
Components
cytoplasm / endoplasmic reticulum membrane / intracellular membrane-bounded organelle
General Function
Steroid hydroxylase activity
Specific Function
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Acts as a 1,4-cineole 2-exo-monooxygenase.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Endoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0019435|Cytochrome P450 2B6 (CYP2B6)
ATGGAACTCAGCGTCCTCCTCTTCCTTGCACTCCTCACAGGACTCTTGCTACTCCTGGTT
CAGCGCCACCCTAACACCCATGACCGCCTCCCACCAGGGCCCCGCCCTCTGCCCCTTTTG
GGAAACCTTCTGCAGATGGATAGAAGAGGCCTACTCAAATCCTTTCTGAGGTTCCGAGAG
AAATATGGGGACGTCTTCACGGTACACCTGGGACCGAGGCCCGTGGTCATGCTGTGTGGA
GTAGAGGCCATACGGGAGGCCCTTGTGGACAAGGCTGAGGCCTTCTCTGGCCGGGGAAAA
ATCGCCATGGTCGACCCATTCTTCCGGGGATATGGTGTGATCTTTGCCAATGGAAACCGC
TGGAAGGTGCTTCGGCGATTCTCTGTGACCACTATGAGGGACTTCGGGATGGGAAAGCGG
AGTGTGGAGGAGCGGATTCAGGAGGAGGCTCAGTGTCTGATAGAGGAGCTTCGGAAATCC
AAGGGGGCCCTCATGGACCCCACCTTCCTCTTCCAGTCCATTACCGCCAACATCATCTGC
TCCATCGTCTTTGGAAAACGATTCCACTACCAAGATCAAGAGTTCCTGAAGATGCTGAAC
TTGTTCTACCAGACTTTTTCACTCATCAGCTCTGTATTCGGCCAGCTGTTTGAGCTCTTC
TCTGGCTTCTTGAAATACTTTCCTGGGGCACACAGGCAAGTTTACAAAAACCTGCAGGAA
ATCAATGCTTACATTGGCCACAGTGTGGAGAAGCACCGTGAAACCCTGGACCCCAGCGCC
CCCAAGGACCTCATCGACACCTACCTGCTCCACATGGAAAAAGAGAAATCCAACGCACAC
AGTGAATTCAGCCACCAGAACCTCAACCTCAACACGCTCTCGCTCTTCTTTGCTGGCACT
GAGACCACCAGCACCACTCTCCGCTACGGCTTCCTGCTCATGCTCAAATACCCTCATGTT
GCAGAGAGAGTCTACAGGGAGATTGAACAGGTGATTGGCCCACATCGCCCTCCAGAGCTT
CATGACCGAGCCAAAATGCCATACACAGAGGCAGTCATCTATGAGATTCAGAGATTTTCC
GACCTTCTCCCCATGGGTGTGCCCCACATTGTCACCCAACACACCAGCTTCCGAGGGTAC
ATCATCCCCAAGGACACAGAAGTATTTCTCATCCTGAGCACTGCTCTCCATGACCCACAC
TACTTTGAAAAACCAGACGCCTTCAATCCTGACCACTTTCTGGATGCCAATGGGGCACTG
AAAAAGACTGAAGCTTTTATCCCCTTCTCCTTAGGGAAGCGGATTTGTCTTGGTGAAGGC
ATCGCCCGTGCGGAATTGTTCCTCTTCTTCACCACCATCCTCCAGAACTTCTCCATGGCC
AGCCCCGTGGCCCCAGAAGACATCGATCTGACACCCCAGGAGTGTGGTGTGGGCAAAATA
CCCCCAACATACCAGATCCGCTTCCTGCCCCGCTGA
Chromosome Location
19
Locus
19q13.2
External Identifiers
ResourceLink
UniProtKB IDP20813
UniProtKB Entry NameCP2B6_HUMAN
GenBank Protein ID181296
GenBank Gene IDM29874
HGNC IDHGNC:2615
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB029744-(4-Chlorophenyl)ImidazoleexperimentalunknownDetails
DB04664Cyclohexyl-pentyl-maltosideexperimentalunknownDetails
DB04794Bifonazoleapproved, investigationalunknownDetails
DB00333MethadoneapprovedunknownsubstrateDetails
DB00531Cyclophosphamideapproved, investigationalunknownsubstrateinducerDetails
DB00532Mephenytoinapproved, investigational, withdrawnunknownsubstrateDetails
DB00625Efavirenzapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB01104SertralineapprovedunknownsubstrateinhibitorDetails
DB01156BupropionapprovedunknownsubstrateinhibitorDetails
DB01181IfosfamideapprovedunknownsubstrateDetails
DB00184NicotineapprovedunknownsubstrateDetails
DB00208TiclopidineapprovedunknowninhibitorDetails
DB00220NelfinavirapprovedunknowninhibitorDetails
DB00238NevirapineapprovedunknownsubstrateinducerDetails
DB00252Phenytoinapproved, vet_approvedunknowninducerDetails
DB00454PethidineapprovedunknownsubstrateDetails
DB00503Ritonavirapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB00564Carbamazepineapproved, investigationalunknowninducerDetails
DB00683Midazolamapproved, illicitunknownsubstrateDetails
DB00758ClopidogrelapprovedunknownsubstrateinhibitorDetails
DB00818Propofolapproved, investigational, vet_approvedunknownsubstrateDetails
DB00849MethylphenobarbitalapprovedunknownsubstrateDetails
DB01037Selegilineapproved, investigational, vet_approvedunknownsubstrateinhibitorDetails
DB01043Memantineapproved, investigationalunknowninhibitorDetails
DB01173OrphenadrineapprovedunknowninhibitorinducerDetails
DB00381AmlodipineapprovedunknowninhibitorDetails
DB00675TamoxifenapprovedunknownsubstrateinhibitorDetails
DB00313Valproic Acidapproved, investigationalunknownsubstrateDetails
DB00568Cinnarizineapproved, investigationalunknownsubstrateDetails
DB04841FlunarizineapprovedunknownsubstrateDetails
DB01075Diphenhydramineapproved, investigationalunknownsubstrateDetails
DB00398Sorafenibapproved, investigationalunknownsubstrateinhibitorDetails
DB04572Thiotepaapproved, investigationalunknowninhibitorDetails
DB01174Phenobarbitalapproved, investigationalunknowninducerDetails
DB01045RifampicinapprovedunknowninducerDetails
DB00762Irinotecanapproved, investigationalunknownsubstrateDetails
DB01069Promethazineapproved, investigationalunknownsubstrateDetails
DB01221Ketamineapproved, vet_approvedunknownsubstrateDetails
DB01320Fosphenytoinapproved, investigationalunknowninducerDetails
DB00794Primidoneapproved, vet_approvedunknowninducerDetails
DB01151Desipramineapproved, investigationalunknowninhibitorDetails
DB00997Doxorubicinapproved, investigationalunknowninhibitorDetails
DB00257Clotrimazoleapproved, vet_approvedunknowninhibitorinducerDetails
DB01167Itraconazoleapproved, investigationalunknowninhibitorDetails
DB00481Raloxifeneapproved, investigationalunknowninhibitorDetails
DB00829Diazepamapproved, illicit, investigational, vet_approvedunknownsubstrateDetails
DB01095FluvastatinapprovedunknowninducerDetails
DB00641SimvastatinapprovedunknowninducerDetails
DB00439Cerivastatinapproved, withdrawnunknowninducerDetails
DB01076AtorvastatinapprovedunknowninducerDetails
DB06739SeratrodastapprovedunknownsubstrateDetails
DB00514DextromethorphanapprovedunknownsubstrateDetails
DB03575PhencyclidineillicitunknowninhibitorDetails
DB00865Benzphetamineapproved, illicitunknownsubstrateDetails
DB083691-(biphenyl-4-ylmethyl)-1H-imidazoleexperimentalunknownDetails
DB06697ArtemetherapprovedunknownsubstrateinducerDetails
DB00321AmitriptylineapprovedunknownsubstrateDetails
DB00701Amprenavirapproved, investigationalunknowninhibitorDetails
DB00972AzelastineapprovedunknowninhibitorDetails
DB00835BrompheniramineapprovedunknownsubstrateDetails
DB00748CarbinoxamineapprovedunknownsubstrateDetails
DB00604Cisaprideapproved, investigational, withdrawnunknownsubstrateDetails
DB00215CitalopramapprovedunknowninhibitorDetails
DB00349Clobazamapproved, illicitunknownsubstrateDetails
DB00636Clofibrateapproved, investigationalunknowninducerDetails
DB06470clomethiazoleinvestigationalunknownsubstrateDetails
DB01559Clotiazepamapproved, illicitunknownsubstrateDetails
DB01394ColchicineapprovedunknowninhibitorDetails
DB00169Cholecalciferolapproved, nutraceuticalunknowninhibitorDetails
DB01234Dexamethasoneapproved, investigational, vet_approvedunknowninducerDetails
DB00586Diclofenacapproved, vet_approvedunknownsubstrateDetails
DB01184Domperidoneapproved, investigational, vet_approvedunknownsubstrateDetails
DB00751Epinastineapproved, investigationalunknownsubstrateDetails
DB00655EstroneapprovedunknownsubstrateDetails
DB00898EthanolapprovedunknowninhibitorDetails
DB01466Ethylmorphineapproved, illicitunknownsubstrateDetails
DB01544Flunitrazepamapproved, illicitunknownsubstrateDetails
DB00472Fluoxetineapproved, vet_approvedunknownsubstrateDetails
DB00176Fluvoxamineapproved, investigationalunknowninhibitorDetails
DB01159Halothaneapproved, vet_approvedunknownsubstrateDetails
DB00458ImipramineapprovedunknownsubstrateDetails
DB00753Isofluraneapproved, vet_approvedunknownsubstrateinhibitorinducerDetails
DB06738Ketobemidoneapproved, investigationalunknownsubstrateDetails
DB01026Ketoconazoleapproved, investigationalunknowninhibitorDetails
DB00281Lidocaineapproved, vet_approvedunknownsubstrateDetails
DB01601LopinavirapprovedunknowninhibitorDetails
DB00772Malathionapproved, investigationalunknownsubstrateDetails
DB04817Metamizoleapproved, investigational, withdrawnunknowninducerDetails
DB01028Methoxyfluraneapproved, investigational, vet_approvedunknownsubstrateDetails
DB06710MethyltestosteroneapprovedunknownsubstrateDetails
DB00379Mexiletineapproved, investigationalunknownsubstrateDetails
DB06148Mianserinapproved, investigationalunknownsubstrateDetails
DB01110Miconazoleapproved, investigational, vet_approvedunknowninhibitorDetails
DB00745Modafinilapproved, investigationalunknowninhibitorinducerDetails
DB00622Nicardipineapproved, investigationalunknowninducerDetails
DB01115NifedipineapprovedunknowninducerDetails
DB00715Paroxetineapproved, investigationalunknowninhibitorDetails
DB01074Perhexilineapproved, investigationalunknownsubstrateDetails
DB04930Permethrinapproved, investigationalunknownsubstrateinducerDetails
DB00850PerphenazineapprovedunknownsubstrateDetails
DB01435Antipyrineapproved, investigationalunknownsubstrateinhibitorDetails
DB00908Quinidineapproved, investigationalunknowninhibitorDetails
DB00296RopivacaineapprovedunknownsubstrateDetails
DB00778Roxithromycinapproved, investigational, withdrawnunknowninhibitorDetails
DB01236Sevofluraneapproved, vet_approvedunknownsubstrateDetails
DB06729SulfaphenazoleapprovedunknowninhibitorDetails
DB01138SulfinpyrazoneapprovedunknowninducerDetails
DB00231Temazepamapproved, investigationalunknownsubstrateDetails
DB00624Testosteroneapproved, investigationalunknownsubstrateinducerDetails
DB00763MethimazoleapprovedunknowninhibitorDetails
DB00193Tramadolapproved, investigationalunknownsubstrateDetails
DB00197Troglitazoneinvestigational, withdrawnunknowninducerDetails
DB00285VenlafaxineapprovedunknowninhibitorDetails
DB00661VerapamilapprovedunknownsubstrateinducerDetails
DB00755Tretinoinapproved, investigational, nutraceuticalunknownsubstrateDetails
DB04868Nilotinibapproved, investigationalunknowninducerDetails
DB06413Armodafinilapproved, investigationalunknowninducerDetails
DB00836LoperamideapprovedunknownsubstrateDetails
DB04975BanoxantroneinvestigationalunknownsubstrateDetails
DB06770Benzyl alcoholapprovedunknownsubstrateDetails
DB00435Nitric OxideapprovedunknowninhibitorDetails
DB00515CisplatinapprovedunknowninhibitorDetails
DB06209PrasugrelapprovedyessubstrateDetails
DB04871LorcaserinapprovednosubstrateDetails
DB08864RilpivirineapprovedunknowninhibitorDetails
DB08896RegorafenibapprovedunknowninhibitorDetails
DB08899EnzalutamideapprovedunknowninhibitorDetails
DB04938Ospemifeneapproved, investigationalunknownsubstrateDetails
DB00199Erythromycinapproved, investigational, vet_approvednosubstrateDetails
DB09074OlaparibapprovedunknowninducerDetails
DB09054IdelalisibapprovednoinducerDetails
DB09068Vortioxetineapproved, investigationalnosubstrateDetails
DB09280LumacaftorapprovednoinducerDetails
DB09570Ixazomibapproved, investigationalunknownsubstrateDetails
DB06176Romidepsinapproved, investigationalunknownsubstrateDetails
DB01589Quazepamapproved, illicitunknowninhibitorDetails
DB08865CrizotinibapprovedunknowninhibitorDetails
DB05219Crisaboroleapproved, investigationalnoinhibitorDetails
DB06595Midostaurinapproved, investigationalunknowninducerDetails
DB11613Velpatasvirapproved, investigationalnosubstrateDetails
DB05541Brivaracetamapproved, investigationalnosubstrateDetails
DB09238Manidipineapproved, investigationalunknowninhibitorDetails
DB13874Enasidenibapproved, investigationalunknownsubstrateinhibitorinducerDetails
DB12070Letermovirapproved, investigationalnoinducerDetails
DB13943Testosterone cypionateapprovedunknownsubstrateinducerDetails
DB13944Testosterone enanthateapprovedunknownsubstrateinducerDetails
DB13946Testosterone undecanoateapproved, investigationalunknownsubstrateinducerDetails
DB13941Piperaquineapproved, investigationalunknowninhibitorDetails
DB11642Pitolisantapproved, investigationalunknowninducerDetails
DB11633Isavuconazoleapproved, investigationalunknowninducerDetails
DB11586Asunaprevirapproved, investigational, withdrawnnosubstrateDetails
DB11672Curcuminapproved, investigationalunknowninhibitorDetails
DB13132ArtemisinininvestigationalnosubstrateDetails
DB00582Voriconazoleapproved, investigationalunknowninhibitorDetails
DB14568Ivosidenibapproved, investigationalunknowninducerDetails
DB00615Rifabutinapproved, investigationalnoinducerDetails
DB11753RifamycininvestigationalnoinducerDetails
DB01201Rifapentineapproved, investigationalnoinducerDetails
DB01220Rifaximinapproved, investigationalnoinducerDetails
DB06654Safinamideapproved, investigationalunknowninhibitorDetails
DB08883PerampanelapprovedunknownDetails
DB09078Lenvatinibapproved, investigationalunknowninhibitorDetails
DB14635Curcumin sulfateexperimentalunknownDetails