Amine oxidase [flavin-containing] A

Details

Name
Amine oxidase [flavin-containing] A
Synonyms
  • 1.4.3.4
  • MAO-A
  • Monoamine oxidase type A
Gene Name
MAOA
Organism
Human
Amino acid sequence
>lcl|BSEQ0004313|Amine oxidase [flavin-containing] A
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV
DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL
NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR
LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD
VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
Number of residues
527
Molecular Weight
59681.27
Theoretical pI
7.96
GO Classification
Functions
primary amine oxidase activity / flavin adenine dinucleotide binding / serotonin binding
Processes
dopamine catabolic process / synaptic transmission / serotonin metabolic process / cellular biogenic amine metabolic process / neurotransmitter secretion / phenylethylamine metabolic process / small molecule metabolic process / neurotransmitter biosynthetic process / xenobiotic metabolic process / neurotransmitter catabolic process
Components
mitochondrion / mitochondrial outer membrane / integral component of membrane
General Function
Serotonin binding
Specific Function
Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.
Pfam Domain Function
Transmembrane Regions
498-518
Cellular Location
Mitochondrion outer membrane
Gene sequence
>lcl|BSEQ0011589|Amine oxidase [flavin-containing] A (MAOA)
ATGGAGAATCAAGAGAAGGCGAGTATCGCGGGCCACATGTTCGACGTAGTCGTGATCGGA
GGTGGCATTTCAGGACTATCTGCTGCCAAACTCTTGACTGAATATGGCGTTAGTGTTTTG
GTTTTAGAAGCTCGGGACAGGGTTGGAGGAAGAACATATACTATAAGGAATGAGCATGTT
GATTACGTAGATGTTGGTGGAGCTTATGTGGGACCAACCCAAAACAGAATCTTACGCTTG
TCTAAGGAGCTGGGCATAGAGACTTACAAAGTGAATGTCAGTGAGCGTCTCGTTCAATAT
GTCAAGGGGAAAACATATCCATTTCGGGGCGCCTTTCCACCAGTATGGAATCCCATTGCA
TATTTGGATTACAATAATCTGTGGAGGACAATAGATAACATGGGGAAGGAGATTCCAACT
GATGCACCCTGGGAGGCTCAACATGCTGACAAATGGGACAAAATGACCATGAAAGAGCTC
ATTGACAAAATCTGCTGGACAAAGACTGCTAGGCGGTTTGCTTATCTTTTTGTGAATATC
AATGTGACCTCTGAGCCTCACGAAGTGTCTGCCCTGTGGTTCTTGTGGTATGTGAAGCAG
TGCGGGGGCACCACTCGGATATTCTCTGTCACCAATGGTGGCCAGGAACGGAAGTTTGTA
GGTGGATCTGGTCAAGTGAGCGAACGGATAATGGACCTCCTCGGAGACCAAGTGAAGCTG
AACCATCCTGTCACTCACGTTGACCAGTCAAGTGACAACATCATCATAGAGACGCTGAAC
CATGAACATTATGAGTGCAAATACGTAATTAATGCGATCCCTCCGACCTTGACTGCCAAG
ATTCACTTCAGACCAGAGCTTCCAGCAGAGAGAAACCAGTTAATTCAGCGGCTTCCAATG
GGAGCTGTCATTAAGTGCATGATGTATTACAAGGAGGCCTTCTGGAAGAAGAAGGATTAC
TGTGGCTGCATGATCATTGAAGATGAAGATGCTCCAATTTCAATAACCTTGGATGACACC
AAGCCAGATGGGTCACTGCCTGCCATCATGGGCTTCATTCTTGCCCGGAAAGCTGATCGA
CTTGCTAAGCTACATAAGGAAATAAGGAAGAAGAAAATCTGTGAGCTCTATGCCAAAGTG
CTGGGATCCCAAGAAGCTTTACATCCAGTGCATTATGAAGAGAAGAACTGGTGTGAGGAG
CAGTACTCTGGGGGCTGCTACACGGCCTACTTCCCTCCTGGGATCATGACTCAATATGGA
AGGGTGATTCGTCAACCCGTGGGCAGGATTTTCTTTGCGGGCACAGAGACTGCCACAAAG
TGGAGCGGCTACATGGAAGGGGCAGTTGAGGCTGGAGAACGAGCAGCTAGGGAGGTCTTA
AATGGTCTCGGGAAGGTGACCGAGAAAGATATCTGGGTACAAGAACCTGAATCAAAGGAC
GTTCCAGCGGTAGAAATCACCCACACCTTCTGGGAAAGGAACCTGCCCTCTGTTTCTGGC
CTGCTGAAGATCATTGGATTTTCCACATCAGTAACTGCCCTGGGGTTTGTGCTGTACAAA
TACAAGCTCCTGCCACGGTCTTGA
Chromosome Location
X
Locus
Xp11.3
External Identifiers
ResourceLink
UniProtKB IDP21397
UniProtKB Entry NameAOFA_HUMAN
GenBank Protein ID187353
GenBank Gene IDM68840
GenAtlas IDMAOA
HGNC IDHGNC:6833
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03147Flavin adenine dinucleotideapprovedunknownDetails
DB01247IsocarboxazidapprovedyesinhibitorDetails
DB01171Moclobemideapproved, investigationalyesantagonistinhibitorDetails
DB00780PhenelzineapprovedyesantagonistDetails
DB00752Tranylcypromineapproved, investigationalyesinhibitorDetails
DB00191Phentermineapproved, illicityesantagonistDetails
DB04850PosizolidinvestigationalunknownDetails
DB05205CX157investigationalunknownDetails
DB00388PhenylephrineapprovedunknownsubstrateDetails
DB00397Phenylpropanolamineapproved, vet_approved, withdrawnunknowninhibitorDetails
DB00669Sumatriptanapproved, investigationalunknownsubstrateDetails
DB00852PseudoephedrineapprovedunknowninhibitorDetails
DB00953RizatriptanapprovedunknownsubstrateDetails
DB01445Bufotenineexperimental, illicitunknownDetails
DB00601Linezolidapproved, investigationalunknowninhibitorDetails
DB00780PhenelzineapprovedunknownsubstrateDetails
DB01171Moclobemideapproved, investigationalunknowninhibitorDetails
DB00140Riboflavinapproved, investigational, nutraceutical, vet_approvedunknowncofactorDetails
DB00191Phentermineapproved, illicitunknowninhibitorDetails
DB00315Zolmitriptanapproved, investigationalunknownsubstrateDetails
DB00624Testosteroneapproved, investigationalunknowninducerDetails
DB00918Almotriptanapproved, investigationalunknownsubstrateDetails
DB00988DopamineapprovedunknownsubstrateDetails
DB01037Selegilineapproved, investigational, vet_approvednoinhibitorDetails
DB01104SertralineapprovedunknownsubstrateDetails
DB00909Zonisamideapproved, investigationalunknowninhibitorDetails
DB07641Decyl(dimethyl)phosphine oxideexperimentalunknownDetails
DB079197-METHOXY-1-METHYL-9H-BETA-CARBOLINEexperimentalunknownDetails
DB04017ClorgilineexperimentalunknownDetails
DB00805MinaprineapprovedyesinhibitorDetails
DB01626PargylineapprovedunknowninhibitorDetails
DB014724-Methoxyamphetamineexperimental, illicitunknowninhibitorDetails
DB01363Ephedraapproved, nutraceutical, withdrawnyesinhibitorDetails
DB01442MMDAexperimental, illicityesinhibitorDetails
DB01577Methamphetamineapproved, illicityesinhibitorDetails
DB00184NicotineapprovedunknowninhibitorDetails
DB00614Furazolidoneexperimental, vet_approvedunknowninhibitorDetails
DB04832ZimelidinewithdrawnunknowninhibitorDetails
DB04820NialamidewithdrawnunknownDetails
DB04821NomifensinewithdrawnunknownDetails
DB06774CapsaicinapprovedunknowninhibitorDetails
DB08804Nandrolone decanoateapproved, illicitunknowninhibitorDetails
DB00952Naratriptanapproved, investigationalunknownsubstrateDetails
DB06654Safinamideapproved, investigationalunknowninhibitorDetails
DB06412Oxymetholoneapproved, illicitunknowninducerDetails
DB13876BrofaromineexperimentalunknowninhibitorDetails
DB13943Testosterone cypionateapprovedunknowninducerDetails
DB13944Testosterone enanthateapprovedunknowninducerDetails
DB13946Testosterone undecanoateapproved, investigationalunknowninducerDetails
DB09245ToloxatoneexperimentalunknownantagonistDetails
DB09245ToloxatoneexperimentalyesinhibitorDetails
DB09244PirlindoleexperimentalunknownantagonistDetails
DB09244PirlindoleexperimentalunknowninhibitorDetails
DB12329Eravacyclineapproved, investigationalyessubstrateDetails
DB00571Propranololapproved, investigationalunknowninhibitorDetails
DB00721Procaineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00182Amphetamineapproved, illicit, investigationalyesinhibitorDetails
DB01168Procarbazineapproved, investigationalyesinhibitorDetails
DB09130Copperapproved, investigationalyescofactorDetails
DB01171Moclobemideapproved, investigationalunknownantagonistDetails
DB09363Rauwolfia serpentina rootinvestigationalunknownsubstrateDetails
DB06778Cupric sulfateapprovedunknownDetails
DB00668Epinephrineapproved, vet_approvedunknownsubstrateDetails