Matrix protein 2
Details
- Name
- Matrix protein 2
- Synonyms
- Proton channel protein M2
- Gene Name
- M
- Organism
- Influenza A virus (strain A/Ann Arbor/6/1960 H2N2)
- Amino acid sequence
>lcl|BSEQ0001256|Matrix protein 2 MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDHLFFKCIYRFFKHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE
- Number of residues
- 97
- Molecular Weight
- 11165.62
- Theoretical pI
- 4.87
- GO Classification
- Functionshydrogen ion transmembrane transporter activity / ion channel activityProcessespore formation by virus in membrane of host cell / protein oligomerization / suppression by virus of host autophagyComponentshost cell plasma membrane / integral component of membrane / integral to membrane of host cell / virion membrane
- General Function
- Ion channel activity
- Specific Function
- Forms a proton-selective ion channel that is necessary for the efficient release of the viral genome during virus entry. After attaching to the cell surface, the virion enters the cell by endocytosis. Acidification of the endosome triggers M2 ion channel activity. The influx of protons into virion interior is believed to disrupt interactions between the viral ribonucleoprotein (RNP), matrix protein 1 (M1), and lipid bilayers, thereby freeing the viral genome from interaction with viral proteins and enabling RNA segments to migrate to the host cell nucleus, where influenza virus RNA transcription and replication occur. Also plays a role in viral proteins secretory pathway. Elevates the intravesicular pH of normally acidic compartments, such as trans-Golgi network, preventing newly formed hemagglutinin from premature switching to the fusion-active conformation (By similarity).
- Pfam Domain Function
- Flu_M2 (PF00599)
- Transmembrane Regions
- 23-43
- Cellular Location
- Virion membrane
- Gene sequence
>lcl|BSEQ0001255|294 bp ATGAGTCTTCTAACCGAGGTCGAAACGCCTATCAGAAACGAATGGGGGTGCAGATGCAAC GATTCAAGTGACCCTCTTGTTGTTGCCGCGAGTATCATTGGGATCTTGCACTTGATATTG TGGATTCTTGATCATCTTTTTTTCAAATGCATTTATCGCTTCTTTAAACACGGTCTGAAA AGAGGGCCTTCTACGGAAGGAGTACCAGAGTCTATGAGGGAAGAATATCGAAAGGAACAG CAGAGTGCTGTGGATGCTGACGATAGTCATTTTGTCAGCATAGAGCTGGAGTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P21430 UniProtKB Entry Name M2_I60A0 GenBank Protein ID 324265 GenBank Gene ID M23978 - General References
- Cox NJ, Kitame F, Kendal AP, Maassab HF, Naeve C: Identification of sequence changes in the cold-adapted, live attenuated influenza vaccine strain, A/Ann Arbor/6/60 (H2N2). Virology. 1988 Dec;167(2):554-67. [Article]
- Nayak DP, Hui EK, Barman S: Assembly and budding of influenza virus. Virus Res. 2004 Dec;106(2):147-65. [Article]
- Lear JD: Proton conduction through the M2 protein of the influenza A virus; a quantitative, mechanistic analysis of experimental data. FEBS Lett. 2003 Sep 18;552(1):17-22. [Article]
- Wu Y, Voth GA: Computational studies of proton transport through the M2 channel. FEBS Lett. 2003 Sep 18;552(1):23-7. [Article]