Carbonic anhydrase 4

Details

Name
Carbonic anhydrase 4
Synonyms
  • 4.2.1.1
  • CA-IV
  • Carbonate dehydratase IV
  • Carbonic anhydrase IV
Gene Name
CA4
Organism
Human
Amino acid sequence
>lcl|BSEQ0001068|Carbonic anhydrase 4
MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTK
AKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSD
LPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF
QPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFRE
PIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
PMLACLLAGFLR
Number of residues
312
Molecular Weight
35032.075
Theoretical pI
7.94
GO Classification
Functions
zinc ion binding / carbonate dehydratase activity
Processes
organ development / response to drug / bicarbonate transport / one-carbon metabolic process / small molecule metabolic process / response to steroid hormone
Components
trans-Golgi network / brush border membrane / transport vesicle membrane / membrane / sarcolemma / plasma membrane / anchored component of external side of plasma membrane / cell surface / sarcoplasmic reticulum / Golgi apparatus / rough endoplasmic reticulum / extracellular exosome / endoplasmic reticulum-Golgi intermediate compartment / perinuclear region of cytoplasm / secretory granule membrane / apical plasma membrane
General Function
Zinc ion binding
Specific Function
Reversible hydration of carbon dioxide. May stimulate the sodium/bicarbonate transporter activity of SLC4A4 that acts in pH homeostasis. It is essential for acid overload removal from the retina and retina epithelium, and acid release in the choriocapillaris in the choroid.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010374|Carbonic anhydrase 4 (CA4)
ATGCGGATGCTGCTGGCGCTCCTGGCCCTCTCCGCGGCGCGGCCATCGGCCAGTGCAGAG
TCACACTGGTGCTACGAGGTTCAAGCCGAGTCCTCCAACTACCCCTGCTTGGTGCCAGTC
AAGTGGGGTGGAAACTGCCAGAAGGACCGCCAGTCCCCCATCAACATCGTCACCACCAAG
GCAAAGGTGGACAAAAAACTGGGACGCTTCTTCTTCTCTGGCTACGATAAGAAGCAAACG
TGGACTGTCCAAAATAACGGGCACTCAGTGATGATGTTGCTGGAGAACAAGGCCAGCATT
TCTGGAGGAGGACTGCCTGCCCCATACCAGGCCAAACAGTTGCACCTGCACTGGTCCGAC
TTGCCATATAAGGGCTCGGAGCACAGCCTCGATGGGGAGCACTTTGCCATGGAGATGCAC
ATAGTACATGAGAAAGAGAAGGGGACATCGAGGAATGTGAAAGAGGCCCAGGACCCTGAA
GACGAAATTGCGGTGCTGGCCTTTCTGGTGGAGGCTGGAACCCAGGTGAACGAGGGCTTC
CAGCCACTGGTGGAGGCACTGTCTAATATCCCCAAACCTGAGATGAGCACTACGATGGCA
GAGAGCAGCCTGTTGGACCTGCTCCCCAAGGAGGAGAAACTGAGGCACTACTTCCGCTAC
CTGGGCTCACTCACCACACCGACCTGCGATGAGAAGGTCGTCTGGACTGTGTTCCGGGAG
CCCATTCAGCTTCACAGAGAACAGATCCTGGCATTCTCTCAGAAGCTGTACTACGACAAG
GAACAGACAGTGAGCATGAAGGACAATGTCAGGCCCCTGCAGCAGCTGGGGCAGCGCACG
GTGATAAAGTCCGGGGCCCCGGGTCGGCCGCTGCCCTGGGCCCTGCCTGCCCTGCTGGGC
CCCATGCTGGCCTGCCTGCTGGCCGGCTTCCTGCGATGA
Chromosome Location
17
Locus
17q23
External Identifiers
ResourceLink
UniProtKB IDP22748
UniProtKB Entry NameCAH4_HUMAN
GenBank Protein ID179791
GenBank Gene IDM83670
GenAtlas IDCA4
HGNC IDHGNC:1375
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00232MethyclothiazideapprovedunknowninhibitorDetails
DB00273TopiramateapprovedyesinhibitorDetails
DB00436BendroflumethiazideapprovedunknowninhibitorDetails
DB00562BenzthiazideapprovedunknowninhibitorDetails
DB00606CyclothiazideapprovedunknowninhibitorDetails
DB00774Hydroflumethiazideapproved, investigationalunknowninhibitorDetails
DB01021Trichlormethiazideapproved, vet_approvedunknowninhibitorDetails
DB00869DorzolamideapprovedunknowninhibitorDetails
DB00909Zonisamideapproved, investigationalunknowninhibitorDetails
DB00819Acetazolamideapproved, vet_approvedyesinhibitorDetails
DB00311EthoxzolamidewithdrawnyesinhibitorDetails
DB00703MethazolamideapprovedyesinhibitorDetails
DB01144Diclofenamideapproved, investigationalyesinhibitorDetails
DB01194BrinzolamideapprovedunknowninhibitorDetails
DB08846Ellagic AcidinvestigationalunknowninhibitorDetails
DB09460Sodium carbonateapprovedunknowninhibitorDetails