Prostaglandin G/H synthase 1

Details

Name
Prostaglandin G/H synthase 1
Synonyms
  • 1.14.99.1
  • COX-1
  • COX1
  • Cyclooxygenase-1
  • PGH synthase 1
  • PGHS-1
  • PHS 1
  • Prostaglandin H2 synthase 1
  • Prostaglandin-endoperoxide synthase 1
Gene Name
PTGS1
Organism
Human
Amino acid sequence
>lcl|BSEQ0036935|Prostaglandin G/H synthase 1
MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR
TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS
NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKF
DPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEA
LVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQEL
VGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS
PEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
Number of residues
599
Molecular Weight
68685.82
Theoretical pI
7.39
GO Classification
Functions
heme binding / peroxidase activity / prostaglandin-endoperoxide synthase activity / lipid binding / metal ion binding / dioxygenase activity
Processes
positive regulation of vasoconstriction / prostaglandin biosynthetic process / response to corticosterone / regulation of cell proliferation / memory / arachidonic acid metabolic process / maintenance of blood-brain barrier / lipid metabolic process / regulation of blood pressure / positive regulation of smooth muscle contraction / aging / response to oxidative stress / sensory perception of pain / response to fatty acid / negative regulation of norepinephrine secretion / negative regulation of epinephrine secretion / inflammatory response / xenobiotic metabolic process / cyclooxygenase pathway / learning / response to organonitrogen compound / small molecule metabolic process
Components
extracellular exosome / cytoplasm / photoreceptor outer segment / intracellular membrane-bounded organelle / nucleus / endoplasmic reticulum membrane / Golgi apparatus / nuclear envelope
General Function
Prostaglandin-endoperoxide synthase activity
Specific Function
Converts arachidonate to prostaglandin H2 (PGH2), a committed step in prostanoid synthesis. Involved in the constitutive production of prostanoids in particular in the stomach and platelets. In gastric epithelial cells, it is a key step in the generation of prostaglandins, such as prostaglandin E2 (PGE2), which plays an important role in cytoprotection. In platelets, it is involved in the generation of thromboxane A2 (TXA2), which promotes platelet activation and aggregation, vasoconstriction and proliferation of vascular smooth muscle cells.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Microsome membrane
Gene sequence
>lcl|BSEQ0021254|Prostaglandin G/H synthase 1 (PTGS1)
ATGAGCCGGAGTCTCTTGCTCTGGTTCTTGCTGTTCCTGCTCCTGCTCCCGCCGCTCCCC
GTCCTGCTCGCGGACCCAGGGGCGCCCACGCCAGTGAATCCCTGTTGTTACTATCCATGC
CAGCACCAGGGCATCTGTGTCCGCTTCGGCCTTGACCGCTACCAGTGTGACTGCACCCGC
ACGGGCTATTCCGGCCCCAACTGCACCATCCCTGGCCTGTGGACCTGGCTCCGGAATTCA
CTGCGGCCCAGCCCCTCTTTCACCCACTTCCTGCTCACTCACGGGCGCTGGTTCTGGGAG
TTTGTCAATGCCACCTTCATCCGAGAGATGCTCATGCGCCTGGTACTCACAGTGCGCTCC
AACCTTATCCCCAGTCCCCCCACCTACAACTCAGCACATGACTACATCAGCTGGGAGTCT
TTCTCCAACGTGAGCTATTACACTCGTATTCTGCCCTCTGTGCCTAAAGATTGCCCCACA
CCCATGGGAACCAAAGGGAAGAAGCAGTTGCCAGATGCCCAGCTCCTGGCCCGCCGCTTC
CTGCTCAGGAGGAAGTTCATACCTGACCCCCAAGGCACCAACCTCATGTTTGCCTTCTTT
GCACAACACTTCACCCACCAGTTCTTCAAAACTTCTGGCAAGATGGGTCCTGGCTTCACC
AAGGCCTTGGGCCATGGGGTAGACCTCGGCCACATTTATGGAGACAATCTGGAGCGTCAG
TATCAACTGCGGCTCTTTAAGGATGGGAAACTCAAGTACCAGGTGCTGGATGGAGAAATG
TACCCGCCCTCGGTAGAAGAGGCGCCTGTGTTGATGCACTACCCCCGAGGCATCCCGCCC
CAGAGCCAGATGGCTGTGGGCCAGGAGGTGTTTGGGCTGCTTCCTGGGCTCATGCTGTAT
GCCACGCTCTGGCTACGTGAGCACAACCGTGTGTGTGACCTGCTGAAGGCTGAGCACCCC
ACCTGGGGCGATGAGCAGCTTTTCCAGACGACCCGCCTCATCCTCATAGGGGAGACCATC
AAGATTGTCATCGAGGAGTACGTGCAGCAGCTGAGTGGCTATTTCCTGCAGCTGAAATTT
GACCCAGAGCTGCTGTTCGGTGTCCAGTTCCAATACCGCAACCGCATTGCCATGGAGTTC
AACCATCTCTACCACTGGCACCCCCTCATGCCTGACTCCTTCAAGGTGGGCTCCCAGGAG
TACAGCTACGAGCAGTTCTTGTTCAACACCTCCATGTTGGTGGACTATGGGGTTGAGGCC
CTGGTGGATGCCTTCTCTCGCCAGATTGCTGGCCGGATCGGTGGGGGCAGGAACATGGAC
CACCACATCCTGCATGTGGCTGTGGATGTCATCAGGGAGTCTCGGGAGATGCGGCTGCAG
CCCTTCAATGAGTACCGCAAGAGGTTTGGCATGAAACCCTACACCTCCTTCCAGGAGCTC
GTAGGAGAGAAGGAGATGGCAGCAGAGTTGGAGGAATTGTATGGAGACATTGATGCGTTG
GAGTTCTACCCTGGACTGCTTCTTGAAAAGTGCCATCCAAACTCTATCTTTGGGGAGAGT
ATGATAGAGATTGGGGCTCCCTTTTCCCTCAAGGGTCTCCTAGGGAATCCCATCTGTTCT
CCGGAGTACTGGAAGCCGAGCACATTTGGCGGCGAGGTGGGCTTTAACATTGTCAAGACG
GCCACACTGAAGAAGCTGGTCTGCCTCAACACCAAGACCTGTCCCTACGTTTCCTTCCGT
GTGCCGGATGCCAGTCAGGATGATGGGCCTGCTGTGGAGCGACCATCCACAGAGCTCTGA
Chromosome Location
9
Locus
9q32-q33.3
External Identifiers
ResourceLink
UniProtKB IDP23219
UniProtKB Entry NamePGH1_HUMAN
GenBank Protein ID387018
GenBank Gene IDM31822
GenAtlas IDPTGS1
HGNC IDHGNC:9604
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00244MesalazineapprovedyesinhibitorDetails
DB00316AcetaminophenapprovedyesinhibitorDetails
DB00328Indomethacinapproved, investigationalunknowninhibitorDetails
DB00461NabumetoneapprovedunknowninhibitorDetails
DB00465KetorolacapprovedunknowninhibitorDetails
DB00469TenoxicamapprovedunknowninhibitorDetails
DB00500TolmetinapprovedunknowninhibitorDetails
DB00554Piroxicamapproved, investigationalunknowninhibitorDetails
DB00573FenoprofenapprovedunknowninhibitorDetails
DB00586Diclofenacapproved, vet_approvedyesinhibitorDetails
DB00749Etodolacapproved, investigational, vet_approvedunknowninhibitorDetails
DB00788Naproxenapproved, vet_approvedyesinhibitorDetails
DB00861DiflunisalapprovedunknowninhibitorDetails
DB00870Suprofenapproved, withdrawnyesinhibitorDetails
DB00939Meclofenamic acidapproved, vet_approvedyesinhibitorDetails
DB00945Acetylsalicylic acidapproved, vet_approvedyesinhibitorDetails
DB00963BromfenacapprovedunknowninhibitorDetails
DB01009Ketoprofenapproved, vet_approvedunknowninhibitorDetails
DB01014Balsalazideapproved, investigationalyesinhibitorDetails
DB01050IbuprofenapprovedyesDetails
DB00154Dihomo-gamma-linolenic acidapproved, nutraceuticalyesinhibitorDetails
DB00159Icosapentapproved, nutraceuticalyesinhibitorDetails
DB00712Flurbiprofenapproved, investigationalunknowninhibitorDetails
DB00784Mefenamic acidapprovedunknowninhibitorDetails
DB01399SalsalateapprovedyesinhibitorDetails
DB00350MinoxidilapprovedunknowninducerDetails
DB00605SulindacapprovedunknowninhibitorDetails
DB00936Salicylic acidapproved, vet_approvedyesinhibitorDetails
DB01283Lumiracoxibapproved, investigationalyesinhibitorDetails
DB01837O-acetyl-L-serineexperimentalunknownDetails
DB02110Protoporphyrin Ix Containing CoexperimentalunknownDetails
DB021982-Bromoacetyl GroupexperimentalunknownDetails
DB03753Flurbiprofen Methyl EsterexperimentalunknownDetails
DB02379Beta-D-GlucoseexperimentalunknownDetails
DB04557Arachidonic AcidexperimentalunknownDetails
DB04817MetamizolewithdrawnunknownDetails
DB03783PhenacetinwithdrawnunknownDetails
DB01892HyperforinnutraceuticalunknowninhibitorDetails
DB02709Resveratrolexperimental, investigationalunknowninhibitorDetails
DB12445NitroaspirininvestigationalunknowninhibitorDetails
DB00814Meloxicamapproved, vet_approvedunknowninhibitorDetails
DB02266Flufenamic AcidexperimentalunknownDetails
DB00991OxaprozinapprovedyesinhibitorDetails
DB01600Tiaprofenic acidapprovedyesinhibitorDetails
DB01397Magnesium salicylateapprovedyesinhibitorDetails
DB00250Dapsoneapproved, investigationalunknownsubstrateDetails
DB01041Thalidomideapproved, investigational, withdrawnunknownsubstrateDetails
DB00711Diethylcarbamazineapproved, vet_approvedunknowninhibitorDetails
DB06725LornoxicamapprovedyesinhibitorDetails
DB00821Carprofenapproved, vet_approved, withdrawnunknowninhibitorDetails
DB00796CandesartanapprovedunknownsubstrateDetails
DB01029Irbesartanapproved, investigationalunknownsubstrateDetails
DB01015SulfamethoxazoleapprovedunknownsubstrateDetails
DB01181IfosfamideapprovedunknownsubstrateDetails
DB00619ImatinibapprovedunknownsubstrateDetails
DB05109Trabectedinapproved, investigationalunknownsubstrateDetails
DB00540NortriptylineapprovedunknownsubstrateDetails
DB00313Valproic Acidapproved, investigationalunknownsubstrateDetails
DB00857Terbinafineapproved, investigational, vet_approvedunknownsubstrateDetails
DB00582Voriconazoleapproved, investigationalunknownsubstrateDetails
DB01075DiphenhydramineapprovedunknownsubstrateDetails
DB00216Eletriptanapproved, investigationalunknownsubstrateDetails
DB01355HexobarbitalapprovedunknownsubstrateDetails
DB00829Diazepamapproved, illicit, vet_approvedunknownsubstrateDetails
DB01136Carvedilolapproved, investigationalunknownsubstrateDetails
DB00470Dronabinolapproved, illicitunknownsubstrateDetails
DB00214TorasemideapprovedunknownsubstrateDetails
DB01198ZopicloneapprovedunknownsubstrateDetails
DB00425ZolpidemapprovedunknownsubstrateDetails
DB00471MontelukastapprovedunknownsubstrateDetails
DB00549Zafirlukastapproved, investigationalunknownsubstrateDetails
DB00744Zileutonapproved, investigational, withdrawnunknownsubstrateDetails
DB00586Diclofenacapproved, vet_approvedunknownsubstrateDetails
DB00533Rofecoxibinvestigational, withdrawnunknownsubstrateDetails
DB00327Hydromorphoneapproved, illicitunknownsubstrateDetails
DB01132Pioglitazoneapproved, investigationalunknownsubstrateDetails
DB00412Rosiglitazoneapproved, investigationalunknownsubstrateDetails
DB01221Ketamineapproved, vet_approvedunknownsubstrateDetails
DB00672ChlorpropamideapprovedunknownsubstrateDetails
DB00731Nateglinideapproved, investigationalunknownsubstrateDetails
DB06737ZaltoprofenapprovedunknownsubstrateDetails
DB06739SeratrodastapprovedunknownsubstrateDetails
DB06738KetobemidoneapprovedunknownsubstrateDetails
DB00812Phenylbutazoneapproved, vet_approvedyesinhibitorDetails
DB00402EszopicloneapprovedunknownsubstrateDetails
DB02773(3-Chloro-4-Propoxy-Phenyl)-Acetic AcidexperimentalunknownDetails
DB020472-(1,1'-Biphenyl-4-Yl)Propanoic AcidexperimentalunknownDetails
DB079812-[1-(4-chlorobenzoyl)-5-methoxy-2-methyl-1H-indol-3-yl]-n-[(1R)-1-(hydroxymethyl)propyl]acetamideexperimentalunknownDetails
DB079831-(4-IODOBENZOYL)-5-METHOXY-2-METHYL INDOLE-3-ACETIC ACIDexperimentalunknownDetails
DB079842-[1-(4-chlorobenzoyl)-5-methoxy-2-methyl-1H-indol-3-yl]-n-[(1S)-1-(hydroxymethyl)propyl]acetamideexperimentalunknownDetails
DB03752P-(2'-Iodo-5'-Thenoyl)Hydrotropic AcidexperimentalunknownDetails
DB03667Acetic Acid Salicyloyl-Amino-EsterexperimentalunknownDetails
DB06802NepafenacapprovedunknowninhibitorDetails
DB00795SulfasalazineapprovedyesinhibitorDetails
DB01435AntipyrineapprovedunknowninhibitorDetails
DB01419AntrafenineapprovedunknowninhibitorDetails
DB01401Choline magnesium trisalicylateapprovedunknowninhibitorDetails
DB08814TriflusalapprovedyesantagonistDetails
DB04552Niflumic AcidapprovedunknownDetails
DB00035DesmopressinapprovedunknowninducerDetails
DB01050IbuprofenapprovedunknowninhibitorDetails
DB00773EtoposideapprovedunknownsubstrateDetails
DB09213DexibuprofenapprovedunknowninhibitorDetails
DB06736AceclofenacapprovedyesinhibitorDetails