Cytochrome c oxidase subunit 7A1, mitochondrial

Details

Name
Cytochrome c oxidase subunit 7A1, mitochondrial
Synonyms
  • COX7AH
  • Cytochrome c oxidase subunit VIIa-H
  • Cytochrome c oxidase subunit VIIa-heart
  • Cytochrome c oxidase subunit VIIa-M
  • Cytochrome c oxidase subunit VIIa-muscle
Gene Name
COX7A1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0012783|Cytochrome c oxidase subunit 7A1, mitochondrial
MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLC
LGGTVYSLYSLGWASFPRN
Number of residues
79
Molecular Weight
9117.44
Theoretical pI
10.52
GO Classification
Functions
cytochrome-c oxidase activity
Processes
generation of precursor metabolites and energy / hydrogen ion transmembrane transport
Components
integral component of membrane / mitochondrial respiratory chain / mitochondrion
General Function
Cytochrome-c oxidase activity
Specific Function
This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Pfam Domain Function
Transmembrane Regions
47-75
Cellular Location
Mitochondrion inner membrane
Gene sequence
>lcl|BSEQ0012784|Cytochrome c oxidase subunit 7A1, mitochondrial (COX7A1)
ATGCAGGCCCTTCGGGTGTCCCAGGCGCTGATCCGCTCCTTCAGCTCCACCGCCCGGAAC
CGCTTTCAGAACCGAGTGCGCGAGAAACAGAAGCTCTTCCAGGAGGACAATGACATCCCG
TTGTACCTGAAGGGCGGCATCGTTGACAACATCCTGTACCGAGTGACAATGACGCTGTGT
CTGGGCGGCACTGTCTACAGCTTGTACTCCCTTGGCTGGGCCTCCTTCCCCAGGAATTAA
Chromosome Location
19
Locus
19q13.1
External Identifiers
ResourceLink
UniProtKB IDP24310
UniProtKB Entry NameCX7A1_HUMAN
GenBank Protein ID181405
GenBank Gene IDM83186
HGNC IDHGNC:2287
General References
  1. Arnaudo E, Hirano M, Seelan RS, Milatovich A, Hsieh CL, Fabrizi GM, Grossman LI, Francke U, Schon EA: Tissue-specific expression and chromosome assignment of genes specifying two isoforms of subunit VIIa of human cytochrome c oxidase. Gene. 1992 Oct 1;119(2):299-305. [Article]
  2. Wolz W, Kress W, Mueller CR: Genomic sequence and organization of the human gene for cytochrome c oxidase subunit (COX7A1) VIIa-M. Genomics. 1997 Oct 15;45(2):438-42. [Article]
  3. Yu M, Jaradat SA, Grossman LI: Genomic organization and promoter regulation of human cytochrome c oxidase subunit VII heart/muscle isoform (COX7AH). Biochim Biophys Acta. 2002 Apr 12;1574(3):345-53. [Article]
  4. Schmidt TR, Goodman M, Grossman LI: Molecular evolution of the COX7A gene family in primates. Mol Biol Evol. 1999 May;16(5):619-26. [Article]
  5. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [Article]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  7. Van Kuilenburg AB, Van Beeumen JJ, Van der Meer NM, Muijsers AO: Subunits VIIa,b,c of human cytochrome c oxidase. Identification of both 'heart-type' and 'liver-type' isoforms of subunit VIIa in human heart. Eur J Biochem. 1992 Jan 15;203(1-2):193-9. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02659Cholic AcidapprovedunknownDetails
DB04464N-FormylmethionineexperimentalunknownDetails