Alpha-1D adrenergic receptor

Details

Name
Alpha-1D adrenergic receptor
Synonyms
  • ADRA1A
  • Alpha-1A adrenergic receptor
  • Alpha-1D adrenoceptor
  • Alpha-1D adrenoreceptor
  • Alpha-adrenergic receptor 1a
Gene Name
ADRA1D
Organism
Human
Amino acid sequence
>lcl|BSEQ0019001|Alpha-1D adrenergic receptor
MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG
SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS
VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC
TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP
PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS
EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC
WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ
CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM
QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE
AVSLGVPHEVAEGATCQAYELADYSNLRETDI
Number of residues
572
Molecular Weight
60462.205
Theoretical pI
9.44
GO Classification
Functions
alpha1-adrenergic receptor activity
Processes
phospholipase C-activating G-protein coupled receptor signaling pathway / norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure / cell-cell signaling / positive regulation of vasoconstriction / cell proliferation / DNA metabolic process / adenylate cyclase-modulating G-protein coupled receptor signaling pathway / positive regulation of cytosolic calcium ion concentration / adenylate cyclase-activating adrenergic receptor signaling pathway / negative regulation of the force of heart contraction involved in baroreceptor response to increased systemic arterial blood pressure / G-protein coupled receptor signaling pathway / positive regulation of smooth muscle contraction / multicellular organismal development / positive regulation of cell proliferation
Components
plasma membrane / cytosol / integral component of plasma membrane
General Function
Alpha1-adrenergic receptor activity
Specific Function
This alpha-adrenergic receptor mediates its effect through the influx of extracellular calcium.
Pfam Domain Function
Transmembrane Regions
96-121 134-159 170-192 214-238 252-275 349-373 381-405
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0019002|Alpha-1D adrenergic receptor (ADRA1D)
ATGACTTTCCGCGATCTCCTGAGCGTCAGTTTCGAGGGACCCCGCCCGGACAGCAGCGCA
GGGGGCTCCAGCGCGGGCGGCGGCGGGGGCAGCGCGGGCGGCGCGGCCCCCTCGGAGGGC
CCGGCGGTGGGCGGCGTGCCGGGGGGCGCGGGCGGCGGCGGCGGCGTGGTGGGCGCAGGC
AGCGGCGAGGACAACCGGAGCTCCGCGGGGGAGCCGGGGAGCGCGGGCGCGGGCGGCGAC
GTGAATGGCACGGCGGCCGTCGGGGGACTGGTGGTGAGCGCGCAGGGCGTGGGCGTGGGC
GTCTTCCTGGCAGCCTTCATCCTTATGGCCGTGGCAGGTAACCTGCTTGTCATCCTCTCA
GTGGCCTGCAACCGCCACCTGCAGACCGTCACCAACTATTTCATCGTGAACCTGGCCGTG
GCCGACCTGCTGCTGAGCGCCACCGTACTGCCCTTCTCGGCCACCATGGAGGTTCTGGGC
TTCTGGGCCTTTGGCCGCGCCTTCTGCGACGTATGGGCCGCCGTGGACGTGCTGTGCTGC
ACGGCCTCCATCCTCAGCCTCTGCACCATCTCCGTGGACCGGTACGTGGGCGTGCGCCAC
TCACTCAAGTACCCAGCCATCATGACCGAGCGCAAGGCGGCCGCCATCCTGGCCCTGCTC
TGGGTCGTAGCCCTGGTGGTGTCCGTAGGGCCCCTGCTGGGCTGGAAGGAGCCCGTGCCC
CCTGACGAGCGCTTCTGCGGTATCACCGAGGAGGCGGGCTACGCTGTCTTCTCCTCCGTG
TGCTCCTTCTACCTGCCCATGGCGGTCATCGTGGTCATGTACTGCCGCGTGTACGTGGTC
GCGCGCAGCACCACGCGCAGCCTCGAGGCGGGCGTCAAGCGCGAGCGAGGCAAGGCCTCC
GAGGTGGTGCTGCGCATCCACTGTCGCGGCGCGGCCACGGGCGCCGACGGGGCGCACGGC
ATGCGCAGCGCCAAGGGCCACACCTTCCGCAGCTCGCTCTCCGTGCGCCTGCTCAAGTTC
TCCCGTGAGAAGAAAGCGGCCAAGACTCTGGCCATCGTCGTGGGTGTCTTCGTGCTCTGC
TGGTTCCCTTTCTTCTTTGTCCTGCCGCTCGGCTCCTTGTTCCCGCAGCTGAAGCCATCG
GAGGGCGTCTTCAAGGTCATCTTCTGGCTCGGCTACTTCAACAGCTGCGTGAACCCGCTC
ATCTACCCCTGTTCCAGCCGCGAGTTCAAGCGCGCCTTCCTCCGTCTCCTGCGCTGCCAG
TGCCGTCGTCGCCGGCGCCGCCGCCCTCTCTGGCGTGTCTACGGCCACCACTGGCGGGCC
TCCACCAGCGGCCTGCGCCAGGACTGCGCCCCGAGTTCGGGCGACGCGCCCCCCGGAGCG
CCGCTGGCCCTCACCGCGCTCCCCGACCCCGACCCCGAACCCCCAGGCACGCCCGAGATG
CAGGCTCCGGTCGCCAGCCGTCGAAAGCCACCCAGCGCCTTCCGCGAGTGGAGGCTGCTG
GGGCCGTTCCGGAGACCCACGACCCAGCTGCGCGCCAAAGTCTCCAGCCTGTCGCACAAG
ATCCGCGCCGGGGGCGCGCAGCGCGCAGAGGCAGCGTGCGCCCAGCGCTCAGAGGTGGAG
GCTGTGTCCCTAGGCGTCCCACACGAGGTGGCCGAGGGCGCCACCTGCCAGGCCTACGAA
TTGGCCGACTACAGCAACCTACGGGAGACCGATATTTAA
Chromosome Location
20
Locus
20p13
External Identifiers
ResourceLink
UniProtKB IDP25100
UniProtKB Entry NameADA1D_HUMAN
GenBank Protein ID177807
GenBank Gene IDM76446
GenAtlas IDADRA1D
HGNC IDHGNC:280
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00298DapiprazoleapprovedyesantagonistDetails
DB00420Promazineapproved, vet_approvedunknownantagonistDetails
DB00706Tamsulosinapproved, investigationalunknownantagonistDetails
DB00777PropiomazineapprovedunknownantagonistDetails
DB01403Methotrimeprazineapproved, investigationalunknownantagonistDetails
DB00368NorepinephrineapprovedyesagonistDetails
DB00590DoxazosinapprovedyesantagonistDetails
DB01162TerazosinapprovedyesantagonistDetails
DB00346Alfuzosinapproved, investigationalyesantagonistDetails
DB04855DronedaroneapprovedunknownDetails
DB06144Sertindoleapproved, investigational, withdrawnunknownDetails
DB05469R450investigationalunknownDetails
DB05492Epicept NP-1investigationalunknownDetails
DB06207SilodosinapprovedunknownantagonistDetails
DB06262Droxidopaapproved, investigationalyesagonistDetails
DB06229OcaperidoneinvestigationalunknownDetails
DB00457PrazosinapprovedyesantagonistDetails
DB00388PhenylephrineapprovedyesDetails
DB01186Pergolideapproved, investigational, vet_approved, withdrawnunknownagonistDetails
DB01200Bromocriptineapproved, investigationalunknownagonistDetails
DB00622Nicardipineapproved, investigationalunknownantagonistDetails
DB01224QuetiapineapprovedunknownantagonistDetails
DB00321AmitriptylineapprovednoantagonistDetails
DB00540NortriptylineapprovednoantagonistDetails
DB00458ImipramineapprovednoantagonistDetails
DB00696Ergotamineapprovedyespartial agonistDetails
DB01142Doxepinapproved, investigationalunknownantagonistDetails
DB06694Xylometazolineapproved, investigationalunknownagonistDetails
DB00668Epinephrineapproved, vet_approvedunknownantagonistDetails
DB01136Carvedilolapproved, investigationalunknownantagonistDetails
DB00575ClonidineapprovedunknownagonistDetails
DB00800FenoldopamapprovedunknowninhibitorDetails
DB00248CabergolineapprovedunknownbinderDetails
DB00211MidodrineapprovedunknownagonistDetails
DB00723Methoxamineapproved, investigationalunknownbinderDetails
DB00925PhenoxybenzamineapprovedunknownantagonistDetails
DB00935Oxymetazolineapproved, investigationalunknownagonistDetails
DB09202Cirazolineexperimentalyespartial agonistDetails
DB00692PhentolamineapprovedunknownantagonistDetails
DB00908Quinidineapproved, investigationalunknownantagonistDetails
DB00661VerapamilapprovedunknownantagonistDetails
DB11124RacepinephrineapprovedyesantagonistDetails
DB06153PizotifenapprovedunknownantagonistDetails
DB00598LabetalolapprovedyesantagonistDetails
DB00934Maprotilineapproved, investigationalnoantagonistDetails
DB01151Desipramineapproved, investigationalnoantagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00370MirtazapineapprovedunknownbinderDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB06148Mianserinapproved, investigationalunknownantagonistDetails
DB13025Tiaprideapproved, investigationalyesantagonistDetails
DB08922PerospironeapprovedunknownantagonistDetails
DB09167DosulepinapprovedyesantagonistDetails
DB09203SynephrineexperimentalunknownDetails
DB09194EtoperidonewithdrawnunknownantagonistDetails
DB09195LorpiprazoleapprovedyesantagonistDetails
DB09204ArotinololinvestigationalyesantagonistDetails
DB09286Pipamperoneapproved, investigationalunknownantagonistDetails
DB01365MephentermineapprovedyesagonistDetails
DB00182Amphetamineapproved, illicit, investigationalunknownagonistDetails
DB09205Moxisylyteapproved, investigationalyesantagonistDetails
DB09229Aranidipineapproved, investigationalunknownagonistDetails
DB11577Indigotindisulfonic AcidapprovednoagonistDetails
DB13345Dihydroergocristineapproved, experimentalyesantagonistagonistDetails
DB01049Ergoloid mesylateapprovedyesantagonistagonistDetails
DB11273DihydroergocornineapprovedyesantagonistagonistDetails
DB11278DL-MethylephedrineapprovedyesagonistDetails