Hemagglutinin
Details
- Name
- Hemagglutinin
- Synonyms
- Fragment
- Hemagglutinin HA1 chain
- Hemagglutinin HA2 chain
- Gene Name
- HA
- Organism
- Influenza A virus (strain A/Mallard/Astrakhan/244/1982 H14N6)
- Amino acid sequence
>lcl|BSEQ0012827|Hemagglutinin LVALALSQTAYSQITNGTTGNPIICLGHHAVENGTSVKTLTDNHVEVVSAKELVETKHTD ELCPSPLKLVDGQDCDLINGALGSPGCDRLQDTTWDVFIERPTAVDTCYPFDVPDYQSLR SILASSGSLEFIAEQFTWNGVKVDGSSSACLRGGRNSFFSRLNWLTKATNGNYGPINVTK ENTGSYVRLYLWGVHHPSSDNEQTDLYKVATGRVTVSTRSDQISIVPNIGSRPRVRNQSG RISIYWTLVNPGDSIIFNSIGNLIAPRGHYKISKSTKSTVLKSDKRIGSCTSPCLTDKGS IQSDKPFQNVSRIAIGNCPKYVKQGSLMLATGMRNIPGKQAKGLFGAIAGFIENGWQGLI DGWYGFRHQNAEGTGTAADLKSTQAAIDQINGKLNRLIEKTNEKYHQIEKEFEQVEGRIQ DLEKYVEDTKIDLWSYNAELLVALENQHTIDVTDSEMNKLFERVRRQLRENAEDQGNGCF EIFHQCDNNCIESIRNGTYDHNIYRDEAINNRIKINPVTLTMGYKDIILWISFSMSCFVF VALILGFVLWACQNGNIRCQICI
- Number of residues
- 563
- Molecular Weight
- 62590.12
- Theoretical pI
- 6.77
- GO Classification
- Processesclathrin-mediated endocytosis of virus by host cell / fusion of virus membrane with host endosome membrane / fusion of virus membrane with host plasma membrane / virion attachment to host cellComponentshost cell plasma membrane / integral component of membrane / viral envelope / virion membrane
- General Function
- Not Available
- Specific Function
- Binds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell. This attachment induces virion internalization of about two third of the virus particles through clathrin-dependent endocytosis and about one third through a clathrin- and caveolin-independent pathway. Plays a major role in the determination of host range restriction and virulence. Class I viral fusion protein. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide. Several trimers are required to form a competent fusion pore.
- Pfam Domain Function
- Hemagglutinin (PF00509)
- Transmembrane Regions
- 527-547
- Cellular Location
- Virion membrane
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P26137 UniProtKB Entry Name HEMA_I82A0 GenBank Gene ID M35996 - General References
- Kawaoka Y, Yamnikova S, Chambers TM, Lvov DK, Webster RG: Molecular characterization of a new hemagglutinin, subtype H14, of influenza A virus. Virology. 1990 Dec;179(2):759-67. [Article]