Amine oxidase [flavin-containing] B

Details

Name
Amine oxidase [flavin-containing] B
Synonyms
  • 1.4.3.4
  • MAO-B
  • Monoamine oxidase type B
Gene Name
MAOB
Organism
Human
Amino acid sequence
>lcl|BSEQ0004309|Amine oxidase [flavin-containing] B
MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR
TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ
TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY
YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER
LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT
FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV
Number of residues
520
Molecular Weight
58762.475
Theoretical pI
7.55
GO Classification
Functions
flavin adenine dinucleotide binding / electron carrier activity / primary amine oxidase activity
Processes
hydrogen peroxide biosynthetic process / negative regulation of serotonin secretion / response to toxic substance / response to drug / xenobiotic metabolic process / response to corticosterone / response to ethanol / response to selenium ion / response to aluminum ion / small molecule metabolic process / substantia nigra development / dopamine catabolic process / positive regulation of dopamine metabolic process / response to lipopolysaccharide
Components
mitochondrion / mitochondrial inner membrane / mitochondrial envelope / mitochondrial outer membrane / integral component of membrane / extracellular exosome
General Function
Primary amine oxidase activity
Specific Function
Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOB preferentially degrades benzylamine and phenylethylamine.
Pfam Domain Function
Transmembrane Regions
490-516
Cellular Location
Mitochondrion outer membrane
Gene sequence
>lcl|BSEQ0016709|Amine oxidase [flavin-containing] B (MAOB)
ATGAGCAACAAATGCGACGTGGTCGTGGTGGGGGGCGGCATCTCAGGTATGGCAGCAGCC
AAACTTCTGCATGACTCTGGACTGAATGTGGTTGTTCTGGAAGCCCGGGACCGTGTGGGA
GGCAGGACTTACACTCTTAGGAACCAAAAGGTTAAATATGTGGACCTTGGAGGATCCTAT
GTTGGACCAACCCAGAATCGTATCTTGAGATTAGCCAAGGAGCTAGGATTGGAGACCTAC
AAAGTGAATGAGGTTGAGCGTCTGATCCACCATGTAAAGGGCAAATCATACCCCTTCAGG
GGGCCATTCCCACCTGTATGGAATCCAATTACCTACTTAGATCATAACAACTTTTGGAGG
ACAATGGATGACATGGGGCGAGAGATTCCGAGTGATGCCCCATGGAAGGCTCCCCTTGCA
GAAGAGTGGGACAACATGACAATGAAGGAGCTACTGGACAAGCTCTGCTGGACTGAATCT
GCAAAGCAGCTTGCCACTCTCTTTGTGAACCTGTGTGTCACTGCAGAGACCCATGAGGTC
TCTGCTCTCTGGTTCCTGTGGTATGTGAAGCAGTGTGGAGGCACAACAAGAATCATCTCG
ACAACAAATGGAGGACAGGAGAGGAAATTTGTGGGCGGATCTGGTCAAGTGAGTGAGCGG
ATAATGGACCTCCTTGGAGACCGAGTGAAGCTGGAGAGGCCTGTGATCTACATTGACCAG
ACAAGAGAAAATGTCCTTGTGGAGACCCTAAACCATGAGATGTATGAGGCTAAATATGTG
ATTAGTGCTATTCCTCCTACTCTGGGCATGAAGATTCACTTCAATCCCCCTCTGCCAATG
ATGAGAAACCAGATGATCACTCGTGTGCCTTTGGGTTCAGTCATCAAGTGTATAGTTTAT
TATAAAGAGCCTTTCTGGAGGAAAAAGGATTACTGTGGAACCATGATTATTGATGGAGAA
GAAGCTCCAGTTGCCTACACGTTGGATGATACCAAACCTGAAGGCAACTATGCTGCCATA
ATGGGATTTATCCTGGCCCACAAAGCCAGAAAACTGGCACGTCTTACCAAAGAGGAAAGG
TTGAAGAAACTTTGTGAACTCTATGCCAAGGTTCTGGGTTCCCTAGAAGCTCTGGAGCCA
GTGCATTATGAAGAAAAGAACTGGTGTGAGGAGCAGTACTCTGGGGGCTGCTACACAACT
TATTTCCCCCCTGGGATCCTGACTCAATATGGAAGGGTTCTACGCCAGCCAGTGGACAGG
ATTTACTTTGCAGGCACCGAGACTGCCACACACTGGAGCGGCTACATGGAGGGGGCTGTA
GAGGCCGGGGAGAGAGCAGCCCGAGAGATCCTGCATGCCATGGGGAAGATTCCAGAGGAT
GAAATCTGGCAGTCAGAACCAGAGTCTGTGGATGTCCCTGCACAGCCCATCACCACCACC
TTTTTGGAGAGACATTTGCCCTCCGTGCCAGGCCTGCTCAGGCTGATTGGATTGACCACC
ATCTTTTCAGCAACGGCTCTTGGCTTCCTGGCCCACAAAAGGGGGCTACTTGTGAGAGTC
TAA
Chromosome Location
X
Locus
Xp11.23
External Identifiers
ResourceLink
UniProtKB IDP27338
UniProtKB Entry NameAOFB_HUMAN
GenBank Protein ID398415
GenBank Gene IDS62734
GenAtlas IDMAOB
HGNC IDHGNC:6834
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00780PhenelzineapprovedyesantagonistDetails
DB01037Selegilineapproved, investigational, vet_approvedyesinhibitorDetails
DB00752Tranylcypromineapproved, investigationalyesinhibitorDetails
DB00191Phentermineapproved, illicityesantagonistDetails
DB01247IsocarboxazidapprovedyesinhibitorDetails
DB02095IsatinexperimentalunknownDetails
DB02211N-Methyl-N-Propargyl-1(R)-AminoindanexperimentalunknownDetails
DB01367RasagilineapprovedyesinhibitorDetails
DB02509FarnesolexperimentalunknownDetails
DB03147Flavin adenine dinucleotideapprovedunknownDetails
DB03894N-Propargyl-1(S)-AminoindanexperimentalunknownDetails
DB04147Lauryl Dimethylamine-N-OxideexperimentalunknownDetails
DB043075-Hydroxy-N-Propargyl-1(R)-AminoindanexperimentalunknownDetails
DB04677N-METHYL-N-[(1R)-1-METHYL-2-PHENYLETHYL]PROP-2-EN-1-AMINEexperimentalunknownDetails
DB06654Safinamideapproved, investigationalyesantagonistDetails
DB01445Bufotenineexperimental, illicitunknownDetails
DB00191Phentermineapproved, illicitunknowninhibitorDetails
DB00614Furazolidoneexperimental, vet_approvedunknowninhibitorDetails
DB00780PhenelzineapprovedunknownsubstrateDetails
DB00915AmantadineapprovedunknowninhibitorDetails
DB01171Moclobemideapproved, investigationalunknownDetails
DB02095IsatinexperimentalunknownDetails
DB02211N-Methyl-N-Propargyl-1(R)-AminoindanexperimentalunknownDetails
DB02509FarnesolexperimentalunknownDetails
DB03147Flavin adenine dinucleotideapprovedunknownDetails
DB03894N-Propargyl-1(S)-AminoindanexperimentalunknownDetails
DB04147Lauryl Dimethylamine-N-OxideexperimentalunknownDetails
DB043075-Hydroxy-N-Propargyl-1(R)-AminoindanexperimentalunknownDetails
DB04818IproniazidwithdrawnunknownDetails
DB04889BicifadineinvestigationalunknownDetails
DB00988DopamineapprovedunknownsubstrateDetails
DB00909Zonisamideapproved, investigationalunknowninhibitorDetails
DB01104SertralineapprovedunknownsubstrateDetails
DB02643N-Dodecyl-N,N-Dimethyl-3-Ammonio-1-PropanesulfonateexperimentalunknownDetails
DB075127-[(3-CHLOROBENZYL)OXY]-2-OXO-2H-CHROMENE-4-CARBALDEHYDEexperimentalunknownDetails
DB075137-[(3-CHLOROBENZYL)OXY]-4-[(METHYLAMINO)METHYL]-2H-CHROMEN-2-ONEexperimentalunknownDetails
DB08082N-(2-AMINOETHYL)-P-CHLOROBENZAMIDEexperimentalunknownDetails
DB08176(1Z)-4-(4-FLUOROPHENYL)-2-METHYLIDENEBUTAN-1-IMINEexperimentalunknownDetails
DB084804-HYDROXY-N-PROPARGYL-1(R)-AMINOINDANexperimentalunknownDetails
DB08516(S)-(+)-2-[4-(FLUOROBENZYLOXY-BENZYLAMINO)PROPIONAMIDE]experimentalunknownDetails
DB01626PargylineapprovedyesinhibitorDetails
DB014724-Methoxyamphetamineexperimental, illicitunknowninhibitorDetails
DB01363Ephedraapproved, nutraceutical, withdrawnyesinhibitorDetails
DB01442MMDAexperimental, illicityesinhibitorDetails
DB01577Methamphetamineapproved, illicityesinhibitorDetails
DB00184NicotineapprovedunknowninhibitorDetails
DB00601Linezolidapproved, investigationalunknowninhibitorDetails
DB04832ZimelidinewithdrawnunknowninhibitorDetails
DB04820NialamidewithdrawnunknownDetails
DB04821NomifensinewithdrawnunknownDetails
DB08804Nandrolone decanoateapproved, illicitunknowninhibitorDetails
DB00182Amphetamineapproved, illicit, investigationalunknowninhibitorDetails
DB01132Pioglitazoneapproved, investigationalunknownDetails
DB01171Moclobemideapproved, investigationalunknownantagonistDetails
DB00721Procaineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00182Amphetamineapproved, illicit, investigationalyesinhibitorDetails
DB01168Procarbazineapproved, investigationalyesinhibitorDetails
DB09130Copperapproved, investigationalyescofactorDetails
DB01171Moclobemideapproved, investigationalunknownantagonistDetails
DB09363Rauwolfia serpentina rootinvestigationalunknownsubstrateDetails
DB06778Cupric sulfateapprovedunknownDetails
DB00668Epinephrineapproved, vet_approvedunknownsubstrateDetails